Grus americana (Whooping crane): 129198520 Help Entry 129198520         CDS       T11359                                  Name (RefSeq) hepatic lectin-like   KO K06563   C-type lectin domain family 4 member L/M Organism game  Grus americana (Whooping crane) Pathway game03260   Virion - Human immunodeficiency virus game03264   Virion - Flavivirus and Alphavirus game03265   Virion - Ebolavirus, Lyssavirus and Morbillivirus game03273   Virion - Lassa virus and SFTS virus game04145   Phagocytosis game04517   IgSF CAM signaling game04625   C-type lectin receptor signaling pathway Brite KEGG Orthology (KO) [BR:game00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03260 Virion - Human immunodeficiency virus     129198520    03264 Virion - Flavivirus and Alphavirus     129198520    03265 Virion - Ebolavirus, Lyssavirus and Morbillivirus     129198520    03273 Virion - Lassa virus and SFTS virus     129198520  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     129198520  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     129198520  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     129198520  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:game04131]     129198520   09183 Protein families: signaling and cellular processes    04054 Pattern recognition receptors [BR:game04054]     129198520    04515 Cell adhesion molecules [BR:game04515]     129198520    04090 CD molecules [BR:game04090]     129198520    04091 Lectins [BR:game04091]     129198520 Membrane trafficking [BR:game04131]  Endocytosis   Phagocytosis    C-lectin receptors     129198520 Pattern recognition receptors [BR:game04054]  Membrane-bound pattern recognition receptors   C-type lectin receptors    129198520 Cell adhesion molecules [BR:game04515]  Lectins   Selectins and C-type lectins    129198520 CD molecules [BR:game04090]  Proteins   129198520 Lectins [BR:game04091]  C-Type lectins   Asialoglycoprotein and DC receptors    129198520 SSDB OrthologParalogGFIT Motif Pfam:  Lectin_C Clec-141-158 Motif Other DBs NCBI-GeneID:  129198520 NCBI-ProteinID:  XP_054663838 LinkDB All DBs Position 33:complement(1103711..1106969) Genome browser AA seq 208 aa AA seqDB search MDEEHLHDDLHVFEDRNFFQLKLRSFFTVYLLLALSFLLNIILFAVSLSRVSTVSSKLSE VRPEQKQNFSSRDSLLFPCGPGSREWEYFDGKCYYFSLTRTSWHKAKAQCEEMRSQLAII NSYAKQNFVMFRTRNERFWIGLTDENSEGEWEWIDGTDYKTTFTFWKEGEPNNSGSNEDC AHIWISGKWNDVYCTYECYYVCEKPLPN NT seq 627 nt NT seq  +upstreamnt  +downstreamnt atggatgaggaacatcttcacgacgatctgcacgttttcgaagacagaaacttcttccag ctgaagctgagatcctttttcacggtgtacttgctactggccctctccttcttgctgaac atcatcctgtttgctgtctcgctctccagagtttcaaccgtttcttctaaactcagcgag gtgaggccggaacagaaacagaacttttccagcagggattcgctgttgtttccctgcgga cccggatcccgagaatgggaatacttcgacgggaaatgttactacttctcgctaaccaga acgagctggcacaaggcgaaggctcagtgcgaagagatgcgctcgcagttggctatcatt aacagctacgccaagcagaattttgtcatgttcaggacgaggaatgagcgtttctggatc gggctgaccgacgagaactcggaaggggaatgggaatggatcgacgggaccgattataaa accacgttcacattttggaaggagggagagcccaacaacagcggcagcaacgaagattgc gcccacatctggatctccgggaagtggaacgacgtctactgcacctacgagtgctactac gtctgcgaaaaacctctgcccaactga

DBGET integrated database retrieval system