Gracilinanus agilis (agile gracile opossum): 123244152
Help
Entry
123244152 CDS
T07702
Name
(RefSeq) guanine nucleotide-binding protein subunit alpha-11
KO
K04635
guanine nucleotide-binding protein subunit alpha-11
Organism
gas
Gracilinanus agilis (agile gracile opossum)
Pathway
gas04020
Calcium signaling pathway
gas04022
cGMP-PKG signaling pathway
gas04081
Hormone signaling
gas04082
Neuroactive ligand signaling
gas04270
Vascular smooth muscle contraction
gas04540
Gap junction
gas04725
Cholinergic synapse
gas04730
Long-term depression
gas04911
Insulin secretion
gas04912
GnRH signaling pathway
gas04925
Aldosterone synthesis and secretion
gas04927
Cortisol synthesis and secretion
gas04928
Parathyroid hormone synthesis, secretion and action
gas04929
GnRH secretion
gas04934
Cushing syndrome
gas04935
Growth hormone synthesis, secretion and action
gas05142
Chagas disease
gas05146
Amoebiasis
gas05163
Human cytomegalovirus infection
gas05170
Human immunodeficiency virus 1 infection
gas05200
Pathways in cancer
Brite
KEGG Orthology (KO) [BR:
gas00001
]
09130 Environmental Information Processing
09132 Signal transduction
04020 Calcium signaling pathway
123244152
04022 cGMP-PKG signaling pathway
123244152
09133 Signaling molecules and interaction
04082 Neuroactive ligand signaling
123244152
04081 Hormone signaling
123244152
09140 Cellular Processes
09144 Cellular community - eukaryotes
04540 Gap junction
123244152
09150 Organismal Systems
09152 Endocrine system
04911 Insulin secretion
123244152
04929 GnRH secretion
123244152
04912 GnRH signaling pathway
123244152
04935 Growth hormone synthesis, secretion and action
123244152
04928 Parathyroid hormone synthesis, secretion and action
123244152
04925 Aldosterone synthesis and secretion
123244152
04927 Cortisol synthesis and secretion
123244152
09153 Circulatory system
04270 Vascular smooth muscle contraction
123244152
09156 Nervous system
04725 Cholinergic synapse
123244152
04730 Long-term depression
123244152
09160 Human Diseases
09161 Cancer: overview
05200 Pathways in cancer
123244152
09172 Infectious disease: viral
05170 Human immunodeficiency virus 1 infection
123244152
05163 Human cytomegalovirus infection
123244152
09174 Infectious disease: parasitic
05146 Amoebiasis
123244152
05142 Chagas disease
123244152
09167 Endocrine and metabolic disease
04934 Cushing syndrome
123244152
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
04147 Exosome [BR:
gas04147
]
123244152
04031 GTP-binding proteins [BR:
gas04031
]
123244152
Exosome [BR:
gas04147
]
Exosomal proteins
Exosomal proteins of other body fluids (saliva and urine)
123244152
Exosomal proteins of melanoma cells
123244152
GTP-binding proteins [BR:
gas04031
]
Heterotrimeric G-proteins
Alpha Subunits
Alpha type 3 (Gq/11) [OT]
123244152
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
G-alpha
Arf
DUF2194
Gtr1_RagA
FtsK_SpoIIIE
Motif
Other DBs
NCBI-GeneID:
123244152
NCBI-ProteinID:
XP_044528399
LinkDB
All DBs
Position
1:complement(734205284..734300680)
Genome browser
AA seq
359 aa
AA seq
DB search
MTLESMMACCLSDEVKESKRINAEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMR
IIHGSGYSEEDKRGFTKLVYQNIFTAMQSMIRAMETLKILYKYEQNKANALLIREVDVEK
VTTFEHQYVSAIKTLWNDPGIQECYDRRREYQLSDSAKYYLTDVDRIATTGYLPTQQDVL
RVRVPTTGIIEYPFDLENIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLV
ESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEDKILYSHLVDYFPEFDGPQR
DAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYNLV
NT seq
1080 nt
NT seq
+upstream
nt +downstream
nt
atgactctggagtccatgatggcgtgttgcctcagcgacgaggtgaaggaatctaagcgg
atcaacgccgagatcgagaagcagctgcggcgggacaagcgggacgccaggcgggagctc
aagttgctcctcctcggcactggtgaaagtggaaagagtacatttattaaacaaatgagg
ataatccatggttcaggctactctgaagaagataagagaggcttcaccaagttggtctac
cagaacatcttcactgccatgcagtccatgatcagggctatggagaccctgaagattctt
tacaagtacgagcagaataaggccaatgcactgctgattcgagaggtggatgttgaaaag
gtcacaacatttgagcatcaatatgtaagtgcaattaagactttgtggaatgaccctgga
atccaggagtgttatgacaggagacgagaatatcagctctccgactcagccaaatactac
ctaactgatgttgaccgcattgccaccactgggtacttacccacccaacaggatgtgctg
cgggttcgagttcccacaactgggatcatagaatatcctttcgacctggagaatatcatc
ttcagaatggtggatgtcggtggacagagatcagagcgaaggaagtggatacactgcttt
gaaaatgtgacgtccatcatgtttttagttgctcttagtgaatatgaccaagttctagtg
gagtctgacaatgagaaccgaatggaagagagtaaagcccttttccggaccattattact
tatccctggttccagaattcctcagtaatcctcttcctcaacaagaaggacctgctggaa
gataagatcttgtattcccacctggtggactatttcccagagtttgatggaccacagagg
gatgcccaggcagccagggagtttatcctcaagatgtttgtggatttaaacccagacagc
gacaaaatcatctactctcactttacatgtgccacagacacggagaacatccgctttgtc
tttgctgctgtcaaagacaccatcctacagctcaatctgaaagaatataacttggtctga
DBGET
integrated database retrieval system