KEGG   Gracilinanus agilis (agile gracile opossum): 123256515
Entry
123256515         CDS       T07702                                 
Name
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit beta-like
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
gas  Gracilinanus agilis (agile gracile opossum)
Pathway
gas01521  EGFR tyrosine kinase inhibitor resistance
gas01522  Endocrine resistance
gas01524  Platinum drug resistance
gas04012  ErbB signaling pathway
gas04014  Ras signaling pathway
gas04015  Rap1 signaling pathway
gas04024  cAMP signaling pathway
gas04062  Chemokine signaling pathway
gas04066  HIF-1 signaling pathway
gas04068  FoxO signaling pathway
gas04070  Phosphatidylinositol signaling system
gas04071  Sphingolipid signaling pathway
gas04072  Phospholipase D signaling pathway
gas04081  Hormone signaling
gas04140  Autophagy - animal
gas04150  mTOR signaling pathway
gas04151  PI3K-Akt signaling pathway
gas04152  AMPK signaling pathway
gas04210  Apoptosis
gas04211  Longevity regulating pathway
gas04213  Longevity regulating pathway - multiple species
gas04218  Cellular senescence
gas04360  Axon guidance
gas04370  VEGF signaling pathway
gas04380  Osteoclast differentiation
gas04510  Focal adhesion
gas04550  Signaling pathways regulating pluripotency of stem cells
gas04611  Platelet activation
gas04613  Neutrophil extracellular trap formation
gas04620  Toll-like receptor signaling pathway
gas04625  C-type lectin receptor signaling pathway
gas04630  JAK-STAT signaling pathway
gas04650  Natural killer cell mediated cytotoxicity
gas04660  T cell receptor signaling pathway
gas04662  B cell receptor signaling pathway
gas04664  Fc epsilon RI signaling pathway
gas04666  Fc gamma R-mediated phagocytosis
gas04668  TNF signaling pathway
gas04670  Leukocyte transendothelial migration
gas04722  Neurotrophin signaling pathway
gas04725  Cholinergic synapse
gas04750  Inflammatory mediator regulation of TRP channels
gas04810  Regulation of actin cytoskeleton
gas04910  Insulin signaling pathway
gas04914  Progesterone-mediated oocyte maturation
gas04915  Estrogen signaling pathway
gas04917  Prolactin signaling pathway
gas04919  Thyroid hormone signaling pathway
gas04923  Regulation of lipolysis in adipocytes
gas04926  Relaxin signaling pathway
gas04929  GnRH secretion
gas04930  Type II diabetes mellitus
gas04931  Insulin resistance
gas04932  Non-alcoholic fatty liver disease
gas04933  AGE-RAGE signaling pathway in diabetic complications
gas04935  Growth hormone synthesis, secretion and action
gas04960  Aldosterone-regulated sodium reabsorption
gas04973  Carbohydrate digestion and absorption
gas05010  Alzheimer disease
gas05017  Spinocerebellar ataxia
gas05020  Prion disease
gas05100  Bacterial invasion of epithelial cells
gas05135  Yersinia infection
gas05142  Chagas disease
gas05146  Amoebiasis
gas05160  Hepatitis C
gas05161  Hepatitis B
gas05162  Measles
gas05163  Human cytomegalovirus infection
gas05164  Influenza A
gas05165  Human papillomavirus infection
gas05166  Human T-cell leukemia virus 1 infection
gas05167  Kaposi sarcoma-associated herpesvirus infection
gas05168  Herpes simplex virus 1 infection
gas05169  Epstein-Barr virus infection
gas05170  Human immunodeficiency virus 1 infection
gas05171  Coronavirus disease - COVID-19
gas05200  Pathways in cancer
gas05203  Viral carcinogenesis
gas05205  Proteoglycans in cancer
gas05206  MicroRNAs in cancer
gas05207  Chemical carcinogenesis - receptor activation
gas05208  Chemical carcinogenesis - reactive oxygen species
gas05210  Colorectal cancer
gas05211  Renal cell carcinoma
gas05212  Pancreatic cancer
gas05213  Endometrial cancer
gas05214  Glioma
gas05215  Prostate cancer
gas05218  Melanoma
gas05220  Chronic myeloid leukemia
gas05221  Acute myeloid leukemia
gas05222  Small cell lung cancer
gas05223  Non-small cell lung cancer
gas05224  Breast cancer
gas05225  Hepatocellular carcinoma
gas05226  Gastric cancer
gas05230  Central carbon metabolism in cancer
gas05231  Choline metabolism in cancer
gas05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
gas05415  Diabetic cardiomyopathy
gas05417  Lipid and atherosclerosis
gas05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:gas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    123256515
   04014 Ras signaling pathway
    123256515
   04015 Rap1 signaling pathway
    123256515
   04370 VEGF signaling pathway
    123256515
   04630 JAK-STAT signaling pathway
    123256515
   04668 TNF signaling pathway
    123256515
   04066 HIF-1 signaling pathway
    123256515
   04068 FoxO signaling pathway
    123256515
   04070 Phosphatidylinositol signaling system
    123256515
   04072 Phospholipase D signaling pathway
    123256515
   04071 Sphingolipid signaling pathway
    123256515
   04024 cAMP signaling pathway
    123256515
   04151 PI3K-Akt signaling pathway
    123256515
   04152 AMPK signaling pathway
    123256515
   04150 mTOR signaling pathway
    123256515
  09133 Signaling molecules and interaction
   04081 Hormone signaling
    123256515
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    123256515
  09143 Cell growth and death
   04210 Apoptosis
    123256515
   04218 Cellular senescence
    123256515
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    123256515
   04550 Signaling pathways regulating pluripotency of stem cells
    123256515
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    123256515
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    123256515
   04613 Neutrophil extracellular trap formation
    123256515
   04620 Toll-like receptor signaling pathway
    123256515
   04625 C-type lectin receptor signaling pathway
    123256515
   04650 Natural killer cell mediated cytotoxicity
    123256515
   04660 T cell receptor signaling pathway
    123256515
   04662 B cell receptor signaling pathway
    123256515
   04664 Fc epsilon RI signaling pathway
    123256515
   04666 Fc gamma R-mediated phagocytosis
    123256515
   04670 Leukocyte transendothelial migration
    123256515
   04062 Chemokine signaling pathway
    123256515
  09152 Endocrine system
   04910 Insulin signaling pathway
    123256515
   04923 Regulation of lipolysis in adipocytes
    123256515
   04929 GnRH secretion
    123256515
   04915 Estrogen signaling pathway
    123256515
   04914 Progesterone-mediated oocyte maturation
    123256515
   04917 Prolactin signaling pathway
    123256515
   04926 Relaxin signaling pathway
    123256515
   04935 Growth hormone synthesis, secretion and action
    123256515
   04919 Thyroid hormone signaling pathway
    123256515
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    123256515
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    123256515
  09156 Nervous system
   04725 Cholinergic synapse
    123256515
   04722 Neurotrophin signaling pathway
    123256515
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    123256515
  09158 Development and regeneration
   04360 Axon guidance
    123256515
   04380 Osteoclast differentiation
    123256515
  09149 Aging
   04211 Longevity regulating pathway
    123256515
   04213 Longevity regulating pathway - multiple species
    123256515
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    123256515
   05206 MicroRNAs in cancer
    123256515
   05205 Proteoglycans in cancer
    123256515
   05207 Chemical carcinogenesis - receptor activation
    123256515
   05208 Chemical carcinogenesis - reactive oxygen species
    123256515
   05203 Viral carcinogenesis
    123256515
   05230 Central carbon metabolism in cancer
    123256515
   05231 Choline metabolism in cancer
    123256515
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    123256515
  09162 Cancer: specific types
   05210 Colorectal cancer
    123256515
   05212 Pancreatic cancer
    123256515
   05225 Hepatocellular carcinoma
    123256515
   05226 Gastric cancer
    123256515
   05214 Glioma
    123256515
   05221 Acute myeloid leukemia
    123256515
   05220 Chronic myeloid leukemia
    123256515
   05218 Melanoma
    123256515
   05211 Renal cell carcinoma
    123256515
   05215 Prostate cancer
    123256515
   05213 Endometrial cancer
    123256515
   05224 Breast cancer
    123256515
   05222 Small cell lung cancer
    123256515
   05223 Non-small cell lung cancer
    123256515
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    123256515
   05170 Human immunodeficiency virus 1 infection
    123256515
   05161 Hepatitis B
    123256515
   05160 Hepatitis C
    123256515
   05171 Coronavirus disease - COVID-19
    123256515
   05164 Influenza A
    123256515
   05162 Measles
    123256515
   05168 Herpes simplex virus 1 infection
    123256515
   05163 Human cytomegalovirus infection
    123256515
   05167 Kaposi sarcoma-associated herpesvirus infection
    123256515
   05169 Epstein-Barr virus infection
    123256515
   05165 Human papillomavirus infection
    123256515
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    123256515
   05100 Bacterial invasion of epithelial cells
    123256515
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    123256515
   05142 Chagas disease
    123256515
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    123256515
   05017 Spinocerebellar ataxia
    123256515
   05020 Prion disease
    123256515
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    123256515
   05418 Fluid shear stress and atherosclerosis
    123256515
   05415 Diabetic cardiomyopathy
    123256515
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    123256515
   04932 Non-alcoholic fatty liver disease
    123256515
   04931 Insulin resistance
    123256515
   04933 AGE-RAGE signaling pathway in diabetic complications
    123256515
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    123256515
   01524 Platinum drug resistance
    123256515
   01522 Endocrine resistance
    123256515
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gas04131]
    123256515
Membrane trafficking [BR:gas04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    123256515
SSDB
Motif
Pfam: RhoGAP SH2 PI3K_P85_iSH2
Other DBs
NCBI-GeneID: 123256515
NCBI-ProteinID: XP_044541049
LinkDB
Position
Unknown
AA seq 370 aa
ALLPDLPEQFVPPEVAPPILQKLVEAIERKGLDSDTLYRPSASEPRPPRIDWTLSDVDQW
DVTTLSEALKGYLQALPRPLVPPGAHGDILHALQETASPAAAAATAGWRRQQLQAALEPP
VVPLHNALTLRFLLQHLGRVAQRARAQGSGLGPRALGEIFGPLLLRLPATGTEQSPDFSA
LFLEMLLQDQEEEQEPPPPALPPKPPKPKVQAGSLSNGSNAPLQEAEWYWGDISREEVNE
KLRDTPDGTFLVRDASSKIQGEYTLTLRKGGNNKLIKVFHRDGQYGFSEPLTFGSVVELI
THYRHESLAQYNAKLDTRLLYPVSKHQQDQVVKEDSVEAVGEQLKVYHQQYQDKSREYDL
LYEEYTRTSQ
NT seq 1112 nt   +upstreamnt  +downstreamnt
gtgccctgctccccgacctgcctgagcagtttgtgcctcccgaggtggcaccacccatcc
ttcagaagttggtggaagccattgaacgaaaagggctggacagcgacacgctctacagac
cgtctgcttctgagccgcggcccccgaggatcgactggactctgagtgatgtagatcagt
gggacgtgaccaccctttccgaggccctgaagggctacctccaagcactgcccaggcccc
ttgtgccccctggagcccatggggatatcctccatgccttacaggagacggccagcccgg
ccgcagcggcggcaacagcggggtggagaagacagcagctgcaggcggcgctcgagcccc
ccgtggttccccttcacaatgccctgactctgcgcttcctgctccagcacctggggagag
tggcccagcgggcccgggcccagggcagcggactgggccccagggccctcggggagatct
ttggacctctcctgcttaggctgccagccactgggactgagcagagccccgacttctcgg
ccttgttcttggaaatgctgctgcaggaccaggaggaggagcaggagccgccccctccag
ccctacccccaaaacctcccaaacccaaggtccaggctggcagcctgtctaatgggagca
acgcccctctccaggaagccgagtggtattggggtgacatttccagggaggaggtgaatg
agaaacttcgcgacactccagatggcaccttcctagtccgggatgcatctagcaagatcc
agggcgaatacaccctgaccctcaggaagggcggcaacaacaagctgatcaaagtcttcc
accgagacgggcagtacggcttctcggaacccctgaccttcggctccgtggtggagctca
tcacccactacagacacgagtcgctggcccagtacaatgccaagctggacacccggctgc
tctatcccgtgtccaagcatcagcaggaccaggtggtgaaggaggacagtgtggaggcag
ttggagaacagctgaaagtttaccatcagcagtatcaggataagagccgagaatacgacc
tgctctacgaggaatatacacgcacttcccag

DBGET integrated database retrieval system