Geobacillus sp. 12AMOR1: GARCT_00082 Help Entry GARCT_00082       CDS       T03966                                  Symbol folB Name (GenBank) Dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism gea  Geobacillus sp. 12AMOR1 Pathway gea00790   Folate biosynthesis gea01100   Metabolic pathways gea01240   Biosynthesis of cofactors Module gea_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:gea00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     GARCT_00082 (folB) Enzymes [BR:gea01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      GARCT_00082 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      GARCT_00082 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      GARCT_00082 (folB) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  FolB WHD_CHMP7 Motif Other DBs NCBI-ProteinID:  AKM17453 LinkDB All DBs Position 84637..84972 Genome browser AA seq 111 aa AA seqDB search MEFYGYHGVLREENVLGQRFLVDVALELDLRPAGRSDRLEHTVNYAEVYERCRTIVEERT LALIEAVAEAIADELLAAFPAVQRCTVKVIKPNPPIRGHYQHVAVEIYRGR NT seq 336 nt NT seq  +upstreamnt  +downstreamnt atggaattttacggttatcacggagtgctccgagaagaaaacgtcctcggccagcggttt ttggtcgatgtggcccttgagctcgacttgcgcccagccggccggagcgaccgtctcgag catacggtgaactatgcggaagtatacgagcgctgtcggacgatcgtggaagagaggacg ctcgccttgatcgaagcggttgccgaggcgatcgcggatgagctgcttgccgctttcccc gccgttcagcggtgcacggtgaaagtaatcaagccgaatccgcccattcgcggccattat cagcatgtcgccgttgaaatctacagggggcggtaa

DBGET integrated database retrieval system