Geospiza fortis (medium ground-finch): 102034653 Help Entry 102034653         CDS       T03755                                  Name (RefSeq) hepatic lectin-like   KO K06563   C-type lectin domain family 4 member L/M Organism gfr  Geospiza fortis (medium ground-finch) Pathway gfr03260   Virion - Human immunodeficiency virus gfr03264   Virion - Flavivirus and Alphavirus gfr03265   Virion - Ebolavirus, Lyssavirus and Morbillivirus gfr03273   Virion - Lassa virus and SFTS virus gfr04145   Phagosome gfr04625   C-type lectin receptor signaling pathway Brite KEGG Orthology (KO) [BR:gfr00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03260 Virion - Human immunodeficiency virus     102034653    03264 Virion - Flavivirus and Alphavirus     102034653    03265 Virion - Ebolavirus, Lyssavirus and Morbillivirus     102034653    03273 Virion - Lassa virus and SFTS virus     102034653  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     102034653  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     102034653  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:gfr04131]     102034653   09183 Protein families: signaling and cellular processes    04054 Pattern recognition receptors [BR:gfr04054]     102034653    04515 Cell adhesion molecules [BR:gfr04515]     102034653    04090 CD molecules [BR:gfr04090]     102034653    04091 Lectins [BR:gfr04091]     102034653 Membrane trafficking [BR:gfr04131]  Endocytosis   Phagocytosis    C-lectin receptors     102034653 Pattern recognition receptors [BR:gfr04054]  Membrane-bound pattern recognition receptors   C-type lectin receptors    102034653 Cell adhesion molecules [BR:gfr04515]  Lectins   Selectins and C-type lectins    102034653 CD molecules [BR:gfr04090]  Proteins   102034653 Lectins [BR:gfr04091]  C-Type lectins   Asialoglycoprotein and DC receptors    102034653 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Lectin_C Motif Other DBs NCBI-GeneID:  102034653 NCBI-ProteinID:  XP_014166847 LinkDB All DBs Position Un AA seq 193 aa AA seqDB search MDEEELQDDLRLFPGGTPGFFLLFQGFSQFPISSISSKLHQEKQEWNFSSWDSFLFPCGA DSREWEYFSGNCYYFSLARLSWERARERCRERRADLVVVGSFAEQQFLMSRARNERFWIG LTDRNSEGNWEWVDGTDYKSSFTFWQEGEPNDSGNNEDCAHLWISGKWNDVHCTFECFFV CERPLAQKSPFSH NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggacgaagaggagctccaggatgacctgcgcctcttcccaggtggaactcctggattt ttcctgcttttccaaggtttttcccaatttcccatttcctccatttcctccaaactccac caggagaaacaggaatggaatttttccagttgggattccttcctgttcccgtgcggggcg gattcccgggaatgggaatatttctctgggaattgttattatttctcgctggcgcggctg agctgggagcgggcgcgggagcggtgccgggagcgccgcgccgacctggtcgtggtgggc agcttcgccgagcagcagttcctgatgtcccgcgcgcggaacgagcgcttctggatcggc ctcaccgaccggaattccgagggaaactgggaatgggtcgatggcaccgactacaaatcc tccttcacgttttggcaggagggggagcccaacgacagcgggaataacgaggattgcgct cacctctggatctccgggaagtggaacgacgtccactgcaccttcgagtgcttcttcgtc tgcgaacgcccccttgcccaaaaatcccctttttcccactaa

DBGET integrated database retrieval system