Geospiza fortis (medium ground-finch): 102035586 Help Entry 102035586         CDS       T03755                                  Symbol DHFR Name (RefSeq) dihydrofolate reductase   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism gfr  Geospiza fortis (medium ground-finch) Pathway gfr00670   One carbon pool by folate gfr00790   Folate biosynthesis gfr01100   Metabolic pathways gfr01240   Biosynthesis of cofactors gfr04981   Folate transport and metabolism Brite KEGG Orthology (KO) [BR:gfr00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     102035586 (DHFR)    00670 One carbon pool by folate     102035586 (DHFR)  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     102035586 (DHFR) Enzymes [BR:gfr01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      102035586 (DHFR) SSDB OrthologParalogGFIT Motif Pfam:  DHFR_1 US2 Motif Other DBs NCBI-GeneID:  102035586 NCBI-ProteinID:  XP_005427042 UniProt:  A0A8N5EVC0 LinkDB All DBs Position Un AA seq 153 aa AA seqDB search MTSTARVEGKQNAVIMGKKTWFSIPEKNRPLKDRINIVLSRELKETPKGAHYLSKSLDDA LALLDSPELKSKVDMVWIVGGTSVYKAAMEKPIHHRLFVTRILKEFESDTFFPEIDHKDY KLLTEYPGVPADIQEENGIQYKFEVYEKTVMAQ NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atgacgagcacggcccgtgtggaaggtaaacagaatgcagtgataatgggtaaaaaaacg tggttctccatccctgagaagaaccgtcctttaaaagacaggattaatattgtgctcagc agggagctcaaggaaaccccaaaaggagcacattatctttccaaaagtctggatgatgct ttagctcttttggattcaccagagttaaaaagtaaagtagacatggtctggatcgtggga ggcacttcagtgtacaaggcagcaatggagaagccaattcatcatcgattgtttgtgaca agaatcttgaaagagtttgaaagtgacacattttttccagaaattgaccataaagactac aagcttctaacagagtacccaggtgtccctgctgatatccaagaagagaatgggatccag tacaaatttgaagtgtatgaaaaaactgtcatggcacaataa

DBGET integrated database retrieval system