Geospiza fortis (medium ground-finch): 102035880 Help Entry 102035880         CDS       T03755                                  Symbol FGF2 Name (RefSeq) fibroblast growth factor 2   KO K18497   fibroblast growth factor 2 Organism gfr  Geospiza fortis (medium ground-finch) Pathway gfr04010   MAPK signaling pathway gfr04020   Calcium signaling pathway gfr04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:gfr00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102035880 (FGF2)    04020 Calcium signaling pathway     102035880 (FGF2)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     102035880 (FGF2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:gfr04052]     102035880 (FGF2)    00536 Glycosaminoglycan binding proteins [BR:gfr00536]     102035880 (FGF2) Cytokines and neuropeptides [BR:gfr04052]  Cytokines   Growth factors (RTK binding)    102035880 (FGF2) Glycosaminoglycan binding proteins [BR:gfr00536]  Heparan sulfate / Heparin   Growth factors/receptors    102035880 (FGF2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  FGF IL1 Glyco_transf_15 Motif Other DBs NCBI-GeneID:  102035880 NCBI-ProteinID:  XP_014164967 UniProt:  A0A6I9Z975 LinkDB All DBs Position Un AA seq 100 aa AA seqDB search MAEKVKLQLQAEERGVVSIKGVSANRFLAMKEDGRLLALKYATEECFFFERLESNNYNTY RSRKYSDWYVALKRTGQYKPGPKTGPGQKAILFLPMSAKS NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atggctgaaaaagtcaagctgcagcttcaggcggaggagcgaggagtggtgtccatcaaa ggtgtcagtgccaatcgcttcctggccatgaaggaggatggcagactgctggccttgaaa tacgcaacagaagaatgtttcttttttgaacgtttggaatccaataactacaacacttac cggtcacggaaatactcagattggtacgtggcactgaaaagaactggacagtacaaacct ggaccaaaaactggacctggacagaaagctatccttttccttcccatgtctgctaaaagc tga

DBGET integrated database retrieval system