Geospiza fortis (medium ground-finch): 102042890 Help Entry 102042890         CDS       T03755                                  Symbol IFNG Name (RefSeq) interferon gamma   KO K04687   interferon gamma Organism gfr  Geospiza fortis (medium ground-finch) Pathway gfr03050   Proteasome gfr04060   Cytokine-cytokine receptor interaction gfr04217   Necroptosis gfr04350   TGF-beta signaling pathway gfr05164   Influenza A gfr05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:gfr00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03050 Proteasome     102042890 (IFNG)  09130 Environmental Information Processing   09132 Signal transduction    04350 TGF-beta signaling pathway     102042890 (IFNG)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102042890 (IFNG)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     102042890 (IFNG)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     102042890 (IFNG)    05168 Herpes simplex virus 1 infection     102042890 (IFNG)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03051 Proteasome [BR:gfr03051]     102042890 (IFNG)   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:gfr04052]     102042890 (IFNG)    00536 Glycosaminoglycan binding proteins [BR:gfr00536]     102042890 (IFNG) Proteasome [BR:gfr03051]  Eukaryotic proteasome   Assembling factors    Other assembling factors     102042890 (IFNG) Cytokines and neuropeptides [BR:gfr04052]  Cytokines   Interferons    102042890 (IFNG) Glycosaminoglycan binding proteins [BR:gfr00536]  Heparan sulfate / Heparin   Cytokines    102042890 (IFNG) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IFN-gamma Fib_alpha DUF948 Hormone_1 Sec8_N Lipoprotein_20 TelK_muzzle ADIP FtsL_2 ATG14 OVT1 Motif Other DBs NCBI-GeneID:  102042890 NCBI-ProteinID:  XP_005419288 UniProt:  A0A6I9HET0 LinkDB All DBs Position Un AA seq 165 aa AA seqDB search MAFQTYSLFVLSVIMISFGHVENRLNLLQLQNDIDKLKADFNSSHSDVADGGPIFTERLK SWTERNEKEIILSQIISMYLEMLESTDRSKEHVRNITEELYTLKKSLSDGSKKMEDLKDL TKLQMSDLKVQRKAVNELFSVLQKLGDTSSSHKRKRSQFQRLCKC NT seq 498 nt NT seq  +upstreamnt  +downstreamnt atggccttccaaacttacagcttgtttgttctgtctgtcatcatgatttcttttggacat gttgaaaatagattgaatcttcttcaacttcaaaatgatatagacaaactgaaagctgat tttaactcaagtcattctgatgtagctgatggcggacctatttttacagagaggctgaaa agctggacagagagaaatgaaaaggagatcatcctgagtcagattatttccatgtacttg gaaatgcttgaaagcactgacaggtcaaaggagcatgtcaggaacataactgaggagctc tacactctgaaaaaaagtctctctgatggctcaaagaagatggaagatctcaaggacctg acaaaacttcagatgagtgacttgaaagttcagcgcaaggctgtaaatgagctgttcagc gtcttacagaaactgggggatacctcaagttctcacaaaagaaaaagaagccagtttcag aggctgtgcaaatgctaa

DBGET integrated database retrieval system