Glossina fuscipes (tsetse fly): 119637366 Help Entry 119637366         CDS       T09630                                  Name (RefSeq) dihydrofolate reductase-like   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism gfs  Glossina fuscipes (tsetse fly) Pathway gfs00670   One carbon pool by folate gfs00790   Folate biosynthesis gfs01100   Metabolic pathways gfs01240   Biosynthesis of cofactors gfs04981   Folate transport and metabolism Brite KEGG Orthology (KO) [BR:gfs00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     119637366    00670 One carbon pool by folate     119637366  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     119637366 Enzymes [BR:gfs01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      119637366 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  DHFR_1 Motif Other DBs NCBI-GeneID:  119637366 NCBI-ProteinID:  XP_037889274 UniProt:  A0A9C5Z4D2 LinkDB All DBs Position Unknown AA seq 113 aa AA seqDB search MLKFYLIVAVSKNVGIGLKGGLPWELKSELRYFSEITRVFDSTKRNVVTKGRKTYFGIPL SNRPLRSRMNIVLSTTLTKEGELPEEVLLQPNLEAAVKFLEDNNTLKSSIETI NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atgttgaaattttatttaatcgttgctgtttcaaaaaatgttgggattggtttgaaaggc ggtttaccatgggaattgaaatccgaacttagatactttagcgagataacacgagtattt gattctactaaacgcaatgtagttacaaagggacgtaaaacttatttcggaataccgctc agtaatagaccgttgcgcagtagaatgaacatcgttctaagcacaactttaactaaagag ggtgaacttcccgaagaagttttattgcaacctaatcttgaagcggctgtgaaatttttg gaggacaataatacattaaaaagcagtatagagaccatatga

DBGET integrated database retrieval system