Gallus gallus (chicken): 418001 Help Entry 418001            CDS       T01006                                  Symbol RBX1 Name (RefSeq) E3 ubiquitin-protein ligase RBX1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism gga  Gallus gallus (chicken) Pathway gga03420   Nucleotide excision repair gga04110   Cell cycle gga04114   Oocyte meiosis gga04120   Ubiquitin mediated proteolysis gga04141   Protein processing in endoplasmic reticulum gga04310   Wnt signaling pathway gga04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:gga00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     418001 (RBX1)    04120 Ubiquitin mediated proteolysis     418001 (RBX1)   09124 Replication and repair    03420 Nucleotide excision repair     418001 (RBX1)  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     418001 (RBX1)    04350 TGF-beta signaling pathway     418001 (RBX1)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     418001 (RBX1)    04114 Oocyte meiosis     418001 (RBX1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:gga04121]     418001 (RBX1)    03400 DNA repair and recombination proteins [BR:gga03400]     418001 (RBX1) Enzymes [BR:gga01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      418001 (RBX1) Ubiquitin system [BR:gga04121]  Ubiquitin ligases (E3)   UBL E3 ligases    418001 (RBX1)   Multi subunit type E3    SCF complex     Ring finger protein      418001 (RBX1)    Cul2 complex      418001 (RBX1)    Cul3 complex      418001 (RBX1)    Cul4 complex      418001 (RBX1)    Cul7 complex      418001 (RBX1)    Cul8 complex      418001 (RBX1)    Cul9 complex      418001 (RBX1) DNA repair and recombination proteins [BR:gga03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       418001 (RBX1)     TCR (transcription coupled repair) factors      Cul4-CSA complex       418001 (RBX1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 PHD_NSD Motif Other DBs NCBI-GeneID:  418001 NCBI-ProteinID:  NP_001186179 CGNC:  9088 Ensembl:  ENSGALG00000011993 LinkDB All DBs Position 1:complement(49860867..49871899) Genome browser AA seq 108 aa AA seqDB search MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggcggccgcgatggatgtggacacccccagcggcaccaacagcggcgccggcaagaag cgcttcgaagtgaagaaatggaacgcagtagctctgtgggcatgggacattgtggttgat aactgtgccatttgcagaaaccatattatggatctatgcatagaatgtcaagcaaaccaa gcatcggctacatctgaagagtgcacggttgcatggggtgtctgcaatcacgctttccac ttccactgcatctctcgctggctcaaaactcgccaagtatgcccactggacaacagggaa tgggagttccaaaagtacggacactag

DBGET integrated database retrieval system