Gallus gallus (chicken): 422964 Help Entry 422964            CDS       T01006                                  Symbol TMEM258 Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism gga  Gallus gallus (chicken) Pathway gga00510   N-Glycan biosynthesis gga00513   Various types of N-glycan biosynthesis gga04141   Protein processing in endoplasmic reticulum Module gga_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:gga00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     422964 (TMEM258)    00513 Various types of N-glycan biosynthesis     422964 (TMEM258)  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     422964 (TMEM258) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost5 DUF6512 TctB Phage_holin_3_3 Motif Other DBs NCBI-GeneID:  422964 NCBI-ProteinID:  NP_001006464 CGNC:  2651 Ensembl:  ENSGALG00000038292 UniProt:  Q76LT9 LinkDB All DBs Position 5:complement(485838..487754) Genome browser AA seq 79 aa AA seqDB search MELEAMSRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDIYKELLISLVA SLFMGFGVLFLLLWVGIYV NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggagctagaggcaatgagcaggtacaccagcccggtgaacccggctgtcttcccacac ctcaccgtggtgctgctggccattggcatgttcttcaccgcatggttcttcgtctatgag gtgacatccaccaagtacacgcgagacatctacaaggagctgctgatctcactggtggca tcgctcttcatggggtttggcgtcctgttcctgctgctgtgggttgggatctacgtgtga

DBGET integrated database retrieval system