Geobacillus sp. GHH01: GHH_c00810 Help Entry GHH_c00810        CDS       T02455                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism ggh  Geobacillus sp. GHH01 Pathway ggh00790   Folate biosynthesis ggh01100   Metabolic pathways ggh01240   Biosynthesis of cofactors Module ggh_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:ggh00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     GHH_c00810 (folB) Enzymes [BR:ggh01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      GHH_c00810 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      GHH_c00810 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      GHH_c00810 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB CclA_1 Motif Other DBs NCBI-ProteinID:  AGE20686 UniProt:  L7ZVB0 LinkDB All DBs Position 83220..83555 Genome browser AA seq 111 aa AA seqDB search MEFYGYHGVFREENILGQRFLVDVTLELDLQPAGRSDCLEYTVNYADVYERCRAIVEERT FALIEAVAEAIAADLLAAFPVVERCIVKVTKPNPPIRGHYQHVAVEIDRGR NT seq 336 nt NT seq  +upstreamnt  +downstreamnt atggagttttacggctaccacggggtgtttcgcgaagaaaacatccttggccagcgattt ttggtcgatgtgacgttggagctcgacttgcagcccgccgggcggagcgattgtcttgag tataccgtcaactacgccgatgtgtacgagcgctgccgggcgatcgttgaggagcggacg ttcgccttgatcgaggcggtcgctgaagcgatcgccgccgacttgctcgctgcctttcct gttgtcgagcgctgcattgtcaaagtgacgaagccgaatccgccgattcgcggccattat caacatgtcgcagtcgaaattgataggggtcgttaa

DBGET integrated database retrieval system