| Entry |
|
| Symbol |
PIK3R3
|
| Name |
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit gamma isoform X2
|
| KO |
| K02649 | phosphoinositide-3-kinase regulatory subunit alpha/beta/delta |
|
| Organism |
ggo Gorilla gorilla gorilla (western lowland gorilla)
|
| Pathway |
| ggo01521 | EGFR tyrosine kinase inhibitor resistance |
| ggo04070 | Phosphatidylinositol signaling system |
| ggo04072 | Phospholipase D signaling pathway |
| ggo04213 | Longevity regulating pathway - multiple species |
| ggo04550 | Signaling pathways regulating pluripotency of stem cells |
| ggo04613 | Neutrophil extracellular trap formation |
| ggo04620 | Toll-like receptor signaling pathway |
| ggo04625 | C-type lectin receptor signaling pathway |
| ggo04650 | Natural killer cell mediated cytotoxicity |
| ggo04660 | T cell receptor signaling pathway |
| ggo04662 | B cell receptor signaling pathway |
| ggo04664 | Fc epsilon RI signaling pathway |
| ggo04666 | Fc gamma R-mediated phagosome formation |
| ggo04670 | Leukocyte transendothelial migration |
| ggo04750 | Inflammatory mediator regulation of TRP channels |
| ggo04810 | Regulation of actin cytoskeleton |
| ggo04914 | Progesterone-mediated oocyte maturation |
| ggo04919 | Thyroid hormone signaling pathway |
| ggo04923 | Regulation of lipolysis in adipocytes |
| ggo04932 | Non-alcoholic fatty liver disease |
| ggo04933 | AGE-RAGE signaling pathway in diabetic complications |
| ggo04935 | Growth hormone synthesis, secretion and action |
| ggo04960 | Aldosterone-regulated sodium reabsorption |
| ggo04973 | Carbohydrate digestion and absorption |
| ggo05100 | Bacterial invasion of epithelial cells |
| ggo05163 | Human cytomegalovirus infection |
| ggo05166 | Human T-cell leukemia virus 1 infection |
| ggo05167 | Kaposi sarcoma-associated herpesvirus infection |
| ggo05168 | Herpes simplex virus 1 infection |
| ggo05170 | Human immunodeficiency virus 1 infection |
| ggo05207 | Chemical carcinogenesis - receptor activation |
| ggo05208 | Chemical carcinogenesis - reactive oxygen species |
| ggo05230 | Central carbon metabolism in cancer |
| ggo05235 | PD-L1 expression and PD-1 checkpoint pathway in cancer |
| ggo05418 | Fluid shear stress and atherosclerosis |
|
| Brite |
KEGG Orthology (KO) [BR:ggo00001]
09130 Environmental Information Processing
09132 Signal transduction
04012 ErbB signaling pathway
101129336 (PIK3R3)
04014 Ras signaling pathway
101129336 (PIK3R3)
04015 Rap1 signaling pathway
101129336 (PIK3R3)
04370 VEGF signaling pathway
101129336 (PIK3R3)
04630 JAK-STAT signaling pathway
101129336 (PIK3R3)
04668 TNF signaling pathway
101129336 (PIK3R3)
04066 HIF-1 signaling pathway
101129336 (PIK3R3)
04068 FoxO signaling pathway
101129336 (PIK3R3)
04070 Phosphatidylinositol signaling system
101129336 (PIK3R3)
04072 Phospholipase D signaling pathway
101129336 (PIK3R3)
04071 Sphingolipid signaling pathway
101129336 (PIK3R3)
04024 cAMP signaling pathway
101129336 (PIK3R3)
04151 PI3K-Akt signaling pathway
101129336 (PIK3R3)
04152 AMPK signaling pathway
101129336 (PIK3R3)
04150 mTOR signaling pathway
101129336 (PIK3R3)
09133 Signaling molecules and interaction
04081 Hormone signaling
101129336 (PIK3R3)
04517 IgSF CAM signaling
101129336 (PIK3R3)
04518 Integrin signaling
101129336 (PIK3R3)
09140 Cellular Processes
09141 Transport and catabolism
04145 Phagocytosis
101129336 (PIK3R3)
04140 Autophagy - animal
101129336 (PIK3R3)
09143 Cell growth and death
04210 Apoptosis
101129336 (PIK3R3)
04218 Cellular senescence
101129336 (PIK3R3)
09144 Cellular community - eukaryotes
04510 Focal adhesion
101129336 (PIK3R3)
04550 Signaling pathways regulating pluripotency of stem cells
101129336 (PIK3R3)
09142 Cell motility
04810 Regulation of actin cytoskeleton
101129336 (PIK3R3)
09150 Organismal Systems
09151 Immune system
04611 Platelet activation
101129336 (PIK3R3)
04613 Neutrophil extracellular trap formation
101129336 (PIK3R3)
04620 Toll-like receptor signaling pathway
101129336 (PIK3R3)
04625 C-type lectin receptor signaling pathway
101129336 (PIK3R3)
04650 Natural killer cell mediated cytotoxicity
101129336 (PIK3R3)
04660 T cell receptor signaling pathway
101129336 (PIK3R3)
04662 B cell receptor signaling pathway
101129336 (PIK3R3)
04664 Fc epsilon RI signaling pathway
101129336 (PIK3R3)
04666 Fc gamma R-mediated phagosome formation
101129336 (PIK3R3)
04670 Leukocyte transendothelial migration
101129336 (PIK3R3)
04062 Chemokine signaling pathway
101129336 (PIK3R3)
09152 Endocrine system
04910 Insulin signaling pathway
101129336 (PIK3R3)
04923 Regulation of lipolysis in adipocytes
101129336 (PIK3R3)
04929 GnRH secretion
101129336 (PIK3R3)
04915 Estrogen signaling pathway
101129336 (PIK3R3)
04914 Progesterone-mediated oocyte maturation
101129336 (PIK3R3)
04917 Prolactin signaling pathway
101129336 (PIK3R3)
04926 Relaxin signaling pathway
101129336 (PIK3R3)
04935 Growth hormone synthesis, secretion and action
101129336 (PIK3R3)
04919 Thyroid hormone signaling pathway
101129336 (PIK3R3)
09154 Digestive system
04973 Carbohydrate digestion and absorption
101129336 (PIK3R3)
09155 Excretory system
04960 Aldosterone-regulated sodium reabsorption
101129336 (PIK3R3)
09156 Nervous system
04725 Cholinergic synapse
101129336 (PIK3R3)
04722 Neurotrophin signaling pathway
101129336 (PIK3R3)
09157 Sensory system
04750 Inflammatory mediator regulation of TRP channels
101129336 (PIK3R3)
09158 Development and regeneration
04360 Axon guidance
101129336 (PIK3R3)
04380 Osteoclast differentiation
101129336 (PIK3R3)
09149 Aging
04211 Longevity regulating pathway
101129336 (PIK3R3)
04213 Longevity regulating pathway - multiple species
101129336 (PIK3R3)
09160 Human Diseases
09161 Cancer: overview
05200 Pathways in cancer
101129336 (PIK3R3)
05206 MicroRNAs in cancer
101129336 (PIK3R3)
05205 Proteoglycans in cancer
101129336 (PIK3R3)
05207 Chemical carcinogenesis - receptor activation
101129336 (PIK3R3)
05208 Chemical carcinogenesis - reactive oxygen species
101129336 (PIK3R3)
05203 Viral carcinogenesis
101129336 (PIK3R3)
05230 Central carbon metabolism in cancer
101129336 (PIK3R3)
05231 Choline metabolism in cancer
101129336 (PIK3R3)
05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
101129336 (PIK3R3)
09162 Cancer: specific types
05210 Colorectal cancer
101129336 (PIK3R3)
05212 Pancreatic cancer
101129336 (PIK3R3)
05225 Hepatocellular carcinoma
101129336 (PIK3R3)
05226 Gastric cancer
101129336 (PIK3R3)
05214 Glioma
101129336 (PIK3R3)
05221 Acute myeloid leukemia
101129336 (PIK3R3)
05220 Chronic myeloid leukemia
101129336 (PIK3R3)
05218 Melanoma
101129336 (PIK3R3)
05211 Renal cell carcinoma
101129336 (PIK3R3)
05215 Prostate cancer
101129336 (PIK3R3)
05213 Endometrial cancer
101129336 (PIK3R3)
05224 Breast cancer
101129336 (PIK3R3)
05222 Small cell lung cancer
101129336 (PIK3R3)
05223 Non-small cell lung cancer
101129336 (PIK3R3)
09172 Infectious disease: viral
05166 Human T-cell leukemia virus 1 infection
101129336 (PIK3R3)
05170 Human immunodeficiency virus 1 infection
101129336 (PIK3R3)
05161 Hepatitis B
101129336 (PIK3R3)
05160 Hepatitis C
101129336 (PIK3R3)
05171 Coronavirus disease
101129336 (PIK3R3)
05164 Influenza A
101129336 (PIK3R3)
05162 Measles
101129336 (PIK3R3)
05168 Herpes simplex virus 1 infection
101129336 (PIK3R3)
05163 Human cytomegalovirus infection
101129336 (PIK3R3)
05167 Kaposi sarcoma-associated herpesvirus infection
101129336 (PIK3R3)
05169 Epstein-Barr virus infection
101129336 (PIK3R3)
05165 Human papillomavirus infection
101129336 (PIK3R3)
09171 Infectious disease: bacterial
05135 Yersinia infection
101129336 (PIK3R3)
05100 Bacterial invasion of epithelial cells
101129336 (PIK3R3)
09174 Infectious disease: parasitic
05146 Amoebiasis
101129336 (PIK3R3)
05142 Chagas disease
101129336 (PIK3R3)
09164 Neurodegenerative disease
05010 Alzheimer disease
101129336 (PIK3R3)
05017 Spinocerebellar ataxia
101129336 (PIK3R3)
05020 Prion disease
101129336 (PIK3R3)
09166 Cardiovascular disease
05417 Lipid and atherosclerosis
101129336 (PIK3R3)
05418 Fluid shear stress and atherosclerosis
101129336 (PIK3R3)
05415 Diabetic cardiomyopathy
101129336 (PIK3R3)
09167 Endocrine and metabolic disease
04930 Type II diabetes mellitus
101129336 (PIK3R3)
04932 Non-alcoholic fatty liver disease
101129336 (PIK3R3)
04931 Insulin resistance
101129336 (PIK3R3)
04933 AGE-RAGE signaling pathway in diabetic complications
101129336 (PIK3R3)
09176 Drug resistance: antineoplastic
01521 EGFR tyrosine kinase inhibitor resistance
101129336 (PIK3R3)
01524 Platinum drug resistance
101129336 (PIK3R3)
01522 Endocrine resistance
101129336 (PIK3R3)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
04131 Membrane trafficking [BR:ggo04131]
101129336 (PIK3R3)
Membrane trafficking [BR:ggo04131]
Endocytosis
Rab GTPases and associated proteins
Rab associated proteins
101129336 (PIK3R3)
|
| SSDB |
|
| Motif |
|
| Other DBs |
|
| LinkDB |
|
| Position |
1:join(193796045..193796150,193847570..193847678,193850720..193850818,193861243..193861423,193862159..193862284,193866262..193866404,193872364..193872540,193881773..193881847,193882323..193882493,193884528..193884726)
|
| AA seq |
434 aa
MNQVSCITALPPKPPKPMTSAVPNGMKDSSVSLQDAEWYWGDISREEVNDKLRDMPDGTF
LVRDASTKMQGDYTLTLRKGGNNKLIKIYHRDGKYGFSDPLTFNSVVELINHYHHESLAQ
YNPKLDVKLMYPVSRYQQDQLVKEDNIDAVGKKLQEYHSQYQEKSKEYDRLYEEYTRTSQ
EIQMKRTAIEAFNETIKIFEEQCHTQEQHSKEYIERFRREGNEKEIERIMMNYDKLKSRL
GEIHDSKMRLEQDLKKQALDNREIDKKMNSIKPDLIQLRKIRDQHLVWLNHKGVRQKRLN
VWLGIKNEDADENYFINEEDENLPHYDEKTWFVEDINRVQAEDLLYGKPDGAFLIRESSK
KGCYACSVVADGEVKHCVIYSTARGYGFAEPYNLYSSLKELVLHYQQTSLVQHNDSLNVR
LAYPVHAQMPSLCR |
| NT seq |
1305 nt +upstreamnt +downstreamnt
atgaatcaggtctcctgtataacagctcttccaccaaagccacctaagccaatgacttca
gcagttccaaatggaatgaaggacagttctgtttctcttcaggatgcagaatggtactgg
ggggatatttcaagggaggaggtaaatgacaaattgcgggatatgccagatgggaccttc
ttggtccgagatgcctcaacaaaaatgcagggagattatactttgactttgcggaaggga
ggcaataataagttaataaagatctatcaccgggatggtaaatatggcttttctgatcct
ctgacatttaattccgtggtggagctcattaaccactatcaccatgaatctcttgctcag
tacaatcccaaacttgatgtgaagctgatgtacccagtgtccagataccaacaggatcag
ttggtaaaagaagataatattgatgcagtaggtaaaaaactgcaagaataccactctcag
tatcaggagaagagtaaagagtatgataggctgtatgaagaatatactagaacatcccag
gaaatacagatgaagaggactgcaatagaagcttttaatgaaacaattaaaatatttgaa
gagcagtgtcacacacaagaacaacatagcaaagaatatattgagcgatttcgcagagag
gggaatgaaaaggagattgaacgaattatgatgaattatgataaattgaaatcacgtctg
ggcgagattcatgatagcaaaatgcgtctagagcaggatttgaagaaacaagctttggac
aaccgagaaatagataaaaaaatgaatagtatcaaacctgacctgatccagctgcgaaag
atccgagatcaacaccttgtatggctcaatcacaaaggagtgagacagaaacgcctgaat
gtctggctgggaattaagaatgaggatgctgatgagaactattttatcaatgaggaagat
gaaaacctgccccattatgatgagaaaacctggtttgttgaggatatcaatcgagtacaa
gcagaggacttgctttatgggaaacctgatggtgcattcttaattcgtgagagtagcaag
aaaggatgctatgcttgctctgtggtggccgatggggaagtgaagcactgtgtgatctac
agcactgctcggggctatggctttgcagagccctacaacctgtacagctctctgaaggag
ctagtgctccattaccagcagacatccttggttcagcacaacgactccctcaacgtcagg
cttgcctaccctgttcatgcacagatgccctcgctttgcagataa |