Gossypium hirsutum (upland cotton): 107903283 Help Entry 107903283         CDS       T04793                                  Name (RefSeq) RING-box protein 1a-like   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism ghi  Gossypium hirsutum (upland cotton) Pathway ghi03420   Nucleotide excision repair ghi04120   Ubiquitin mediated proteolysis ghi04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:ghi00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     107903283    04120 Ubiquitin mediated proteolysis     107903283   09124 Replication and repair    03420 Nucleotide excision repair     107903283  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:ghi04121]     107903283    03400 DNA repair and recombination proteins [BR:ghi03400]     107903283 Enzymes [BR:ghi01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      107903283 Ubiquitin system [BR:ghi04121]  Ubiquitin ligases (E3)   UBL E3 ligases    107903283   Multi subunit type E3    SCF complex     Ring finger protein      107903283    Cul2 complex      107903283    Cul3 complex      107903283    Cul4 complex      107903283    Cul7 complex      107903283    Cul8 complex      107903283    Cul9 complex      107903283 DNA repair and recombination proteins [BR:ghi03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       107903283     TCR (transcription coupled repair) factors      Cul4-CSA complex       107903283 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4_2 zf-C3HC4 zf-RING_11 zf-RING_16 RH_dom Motif Other DBs NCBI-GeneID:  107903283 NCBI-ProteinID:  XP_016684799 UniProt:  A0A1U8J9B2 LinkDB All DBs Position D05:2989668..2991335 Genome browser AA seq 101 aa AA seqDB search MSTQTSGSTAPSKHFDMKKWSSVAFWSWDIVVDNCAVCRNHIMDLCIECQANQIHGADNE CTVAWGACNHAFHFHCISRWLQNRSVCPLDNAEWEFRKYGR NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgtctacccaaacttccggcagcaccgccccttccaagcacttcgacatgaaaaagtgg agttcggttgccttctggtcctgggatattgtcgtggataattgtgcggtttgcaggaat cacatcatggatctctgtatcgaatgccaagccaaccaaatacacggtgccgataatgaa tgcactgttgcgtggggtgcatgcaaccatgcattccactttcactgcatcagtcgatgg ctgcagaaccggtcagtgtgtcctttggataatgctgaatgggagttccgaaagtatggt cgctag

DBGET integrated database retrieval system