Gossypium hirsutum (upland cotton): 107914111 Help Entry 107914111         CDS       T04793                                  Name (RefSeq) sm-like protein LSM3B   KO K12622   U6 snRNA-associated Sm-like protein LSm3 Organism ghi  Gossypium hirsutum (upland cotton) Pathway ghi03018   RNA degradation ghi03040   Spliceosome Brite KEGG Orthology (KO) [BR:ghi00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     107914111   09123 Folding, sorting and degradation    03018 RNA degradation     107914111  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:ghi03019]     107914111    03041 Spliceosome [BR:ghi03041]     107914111 Messenger RNA biogenesis [BR:ghi03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      107914111   mRNA degradation factors    5'-3' decay     Lsm complex      107914111 Spliceosome [BR:ghi03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     107914111  Complex C   U2 snRNP components     107914111 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  LSM TIG_SUH Glutaredoxin Motif Other DBs NCBI-GeneID:  107914111 NCBI-ProteinID:  XP_016698355 UniProt:  A0A1U8K781 LinkDB All DBs Position A05:complement(25804067..25806061) Genome browser AA seq 97 aa AA seqDB search MASEEESAVKEPLDLIRLSLDERIYVKLRSDRELRGKLHAYDQHLNMILGDVEEVVTTVE IDDETYEEIVRTTKRTVPFLFVRGDGVILVSPPLRTA NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atggcaagcgaggaagagagcgcggtgaaggagcctttggatttgataaggctcagcctc gacgagcgtatttacgtcaagctccgctctgaccgtgagctccgtggcaagctccatgct tatgatcagcatttgaatatgattctaggtgatgttgaagaggttgttacaacggttgaa atagatgatgaaacctatgaagagattgttcggactacaaagcgcacggttccatttctc tttgttaggggagatggagttatattggtttctccacctctacggactgcttga

DBGET integrated database retrieval system