Gossypium hirsutum (upland cotton): 107932188 Help Entry 107932188         CDS       T04793                                  Name (RefSeq) RING-box protein 1a   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism ghi  Gossypium hirsutum (upland cotton) Pathway ghi03420   Nucleotide excision repair ghi04120   Ubiquitin mediated proteolysis ghi04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:ghi00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     107932188    04120 Ubiquitin mediated proteolysis     107932188   09124 Replication and repair    03420 Nucleotide excision repair     107932188  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:ghi04121]     107932188    03400 DNA repair and recombination proteins [BR:ghi03400]     107932188 Enzymes [BR:ghi01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      107932188 Ubiquitin system [BR:ghi04121]  Ubiquitin ligases (E3)   UBL E3 ligases    107932188   Multi subunit type E3    SCF complex     Ring finger protein      107932188    Cul2 complex      107932188    Cul3 complex      107932188    Cul4 complex      107932188    Cul7 complex      107932188    Cul8 complex      107932188    Cul9 complex      107932188 DNA repair and recombination proteins [BR:ghi03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       107932188     TCR (transcription coupled repair) factors      Cul4-CSA complex       107932188 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 Motif Other DBs NCBI-GeneID:  107932188 NCBI-ProteinID:  XP_016719629 UniProt:  A0A1U8M245 LinkDB All DBs Position D07:1688881..1691145 Genome browser AA seq 118 aa AA seqDB search MATLDSDVPMVPVGESSNSSAASSSTKKPKRFEIKKWSAVALWAWDIVVDNCAICRNHIM DLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atggctactctagactccgatgtccccatggtacccgtcggcgagtcttccaacagctcc gccgcttcctcttccactaagaaacccaagcgtttcgagatcaaaaagtggagcgccgtt gccctttgggcttgggatattgttgtggataattgtgcaatttgtaggaatcacatcatg gatctctgtatcgaatgccaagcaaaccaagccagcgccaccagtgaggaatgcactgtt gcttggggggtctgcaaccatgcatttcactttcactgtatcagccgatggttgaagact cgtcaagtgtgtccattggataatagtgagtgggagttccaaaagtatggtcactaa

DBGET integrated database retrieval system