Gossypium hirsutum (upland cotton): 107932799 Help Entry 107932799         CDS       T04793                                  Name (RefSeq) RING-box protein 1a   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism ghi  Gossypium hirsutum (upland cotton) Pathway ghi03420   Nucleotide excision repair ghi04120   Ubiquitin mediated proteolysis ghi04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:ghi00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     107932799    04120 Ubiquitin mediated proteolysis     107932799   09124 Replication and repair    03420 Nucleotide excision repair     107932799  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:ghi04121]     107932799    03400 DNA repair and recombination proteins [BR:ghi03400]     107932799 Enzymes [BR:ghi01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      107932799 Ubiquitin system [BR:ghi04121]  Ubiquitin ligases (E3)   UBL E3 ligases    107932799   Multi subunit type E3    SCF complex     Ring finger protein      107932799    Cul2 complex      107932799    Cul3 complex      107932799    Cul4 complex      107932799    Cul7 complex      107932799    Cul8 complex      107932799    Cul9 complex      107932799 DNA repair and recombination proteins [BR:ghi03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       107932799     TCR (transcription coupled repair) factors      Cul4-CSA complex       107932799 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  107932799 NCBI-ProteinID:  XP_016720386 UniProt:  A0A1U8M0Q5 LinkDB All DBs Position D08:68771653..68773960 Genome browser AA seq 118 aa AA seqDB search MATLDSDVPMVPAGEASGSSAASSSTKKPKRFEIKKWSAVALWAWDIVVDNCAICRNHIM DLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atggctactctagattccgatgtgccgatggtgcccgccggtgaagcttccggtagctcc gccgcgtcttcctctactaagaagcccaagcgcttcgagatcaagaagtggagtgccgtt gccctctgggcctgggatattgtggtggataattgtgcaatttgcaggaatcacattatg gatctctgtatcgagtgccaagctaaccaagccagcgccaccagtgaggaatgcactgtt gcttggggggtctgcaaccatgcatttcacttccattgtatcagccgatggctcaagact cgtcaagtttgcccattggataacagtgagtgggagttccaaaagtatgggcactag

DBGET integrated database retrieval system