Gossypium hirsutum (upland cotton): 107937709 Help Entry 107937709         CDS       T04793                                  Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism ghi  Gossypium hirsutum (upland cotton) Pathway ghi00510   N-Glycan biosynthesis ghi00513   Various types of N-glycan biosynthesis ghi04141   Protein processing in endoplasmic reticulum Module ghi_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:ghi00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     107937709    00513 Various types of N-glycan biosynthesis     107937709  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     107937709 SSDB OrthologParalogGFIT Motif Pfam:  Ost5 Motif Other DBs NCBI-GeneID:  107937709 NCBI-ProteinID:  XP_016726153 UniProt:  A0A1U8MKV7 LinkDB All DBs Position A05:complement(3063141..3065029) Genome browser AA seq 78 aa AA seqDB search MAPPAKAITSPVPDAWYPTLAVFMLAIGLVLTASFFIYEATSSKRNRSLAKELTTGGVAS VFLGFGSLFLLLSAGVYV NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggcacctcctgcaaaagcaataactagtcccgtgcctgatgcgtggtatccaacccta gccgtcttcatgctcgccattggtcttgtcctcactgcttccttcttcatctacgaagca acttcttccaaacgaaatcgcagtcttgcaaaggagctcacaactgggggagtggcatct gtcttcctgggattcgggtcactgtttttgctactatcagccggcgtttatgtctga

DBGET integrated database retrieval system