Gilvimarinus japonicus: R50076_29970 Help Entry R50076_29970      CDS       T10758                                  Symbol folA Name (GenBank) type 3 dihydrofolate reductase   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism gjp  Gilvimarinus japonicus Pathway gjp00670   One carbon pool by folate gjp00790   Folate biosynthesis gjp01100   Metabolic pathways gjp01240   Biosynthesis of cofactors gjp04981   Folate transport and metabolism Module gjp_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:gjp00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     R50076_29970 (folA)    00670 One carbon pool by folate     R50076_29970 (folA)  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     R50076_29970 (folA) Enzymes [BR:gjp01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      R50076_29970 (folA) SSDB OrthologParalogGFIT Motif Pfam:  DHFR_1 Motif Other DBs NCBI-ProteinID:  BFM21948 LinkDB All DBs Position complement(3553681..3554130) Genome browser AA seq 149 aa AA seqDB search MPWHLPADLQYFKCVTLGKPIMMGRKTYESIGRPLPGRLNIVISRDPSWPAPEGVKCVTN IPEAIALARAEADGDEVMIIGGEQIYRAALPYTDRIYKTEIAVTVEGADAFFPELSAENW REVSRQEGDAEAPLRHHFLVLESCDDTGS NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atgccttggcacctgccggcggatttacaatactttaagtgcgtgaccttgggtaagccc attatgatgggccgcaaaacctatgagtctattggacggccgttacccggtaggctcaat atcgttattagccgcgacccgagctggcctgcgccagaaggggttaaatgtgttaccaac atccccgaggctattgctttggcgcgggccgaagcggatggcgacgaggtgatgattatt ggtggcgagcaaatataccgtgcggcgttaccttatacggatcgtatttataaaacggag atagcggtaacggtagagggggcagatgcgttcttccctgagctatcggccgagaattgg cgggaagtttcccggcaggagggtgatgcagaggctccgctgcgtcatcattttttggta ttggagtcgtgcgatgacaccggttcttaa

DBGET integrated database retrieval system