KEGG   Glarea lozoyensis: GLAREA_09633
Entry
GLAREA_09633      CDS       T04883                                 
Name
(RefSeq) Cytochrome P450
  KO
K15877  fungal nitric oxide reductase [EC:1.7.1.14]
Organism
glz  Glarea lozoyensis
Pathway
glz00910  Nitrogen metabolism
glz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:glz00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    GLAREA_09633
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:glz00199]
    GLAREA_09633
Enzymes [BR:glz01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.14  nitric oxide reductase [NAD(P)+, nitrous oxide-forming]
     GLAREA_09633
Cytochrome P450 [BR:glz00199]
 Cytochrome P450, fungi type
  CYP55 family
   GLAREA_09633
SSDB
Motif
Pfam: p450 PhnG DUF6576
Other DBs
NCBI-GeneID: 19468680
NCBI-ProteinID: XP_008084420
UniProt: S3CPV0
LinkDB
Position
Unknown
AA seq 371 aa
MGSSTTPPKFPFARPSDYQPALEYAQLRANDPVSRVELFDGSIAWLVVKHKDICAVLTDQ
RLSKVMSLTFDGGFDTDQSMVEPIFTKSHIDNTRPKIQETVDKLLDKVTEHGGAEPFDIV
EDILGVPLSDLPYLTQQAAIRGNGSATATESSQANASLLSYIDALVDKRLQKSENDLISL
LVDNQLKAGRLQKADVTQIAFLLLVAGNATMISMIALGIVTALQHPEQLEDLRSEPEKWS
PKFVEELCRYHTASALATKRVAKEDINLGGKLIKKGEGIIAATQSGNRDEEVFPNPDVFD
MKRERRSEEALGYGWGEHRCVAEWLARAELEIVFASIFKRLPGLKLAIPFEEVKYSPPHK
DVGISELSVIF
NT seq 1116 nt   +upstreamnt  +downstreamnt
atgggatccagcaccactcctccaaagtttccctttgctcggccttcagattatcaacca
gcattggaatatgcccaattgagagcgaatgaccctgtgtcgagagttgagctttttgat
ggtagcattgcgtggcttgtggttaagcacaaagatatttgcgctgttttgaccgaccag
cgactctccaaagtaatgagtctaacttttgatggagggtttgacactgaccagagtatg
gtcgagccaatttttaccaagtcccatattgataacacacgcccaaagatacaggagacc
gtggacaaacttctcgacaaagtgaccgagcatgggggagctgaaccattcgatatcgtg
gaggacatcttgggcgttccgctgtctgatctaccatatctcacccaacaagcagctatt
cgtggcaatggttcggcaaccgccacggaatcatcccaagccaacgcttctctactatcc
tatattgacgcacttgtggataagcgacttcagaaatcagaaaacgatctgatctccctt
ttggttgacaaccagctcaaagcaggccgtctccagaaagccgatgtaactcagattgcc
ttcctccttctcgtcgcaggcaatgcgaccatgatttcgatgatcgcgttaggaatcgtg
accgcccttcagcacccagagcagcttgaagatctcagatcagagccggagaaatggtct
cccaagttcgtggaggaactctgcagatatcacaccgcttcagcccttgccaccaaaaga
gtcgcaaaggaagatataaatcttggcggcaagcttatcaaaaagggagaaggtatcatt
gctgcgacccagagcgggaacagagacgaggaggtgttcccaaacccagatgtgtttgat
atgaagagggaacgccgaagtgaggaagctctgggatacggctggggcgaacatagatgt
gttgctgaatggctagcaagagctgaacttgagattgtttttgcgtcgatcttcaagagg
cttcctggtctcaaactagcgatcccctttgaggaggtcaagtactcaccacctcataaa
gacgtgggaatatcagaactatcggttattttttga

DBGET integrated database retrieval system