Gadus morhua (Atlantic cod): 115531294 Help Entry 115531294         CDS       T10832                                  Symbol rbx1 Name (RefSeq) E3 ubiquitin-protein ligase RBX1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism gmh  Gadus morhua (Atlantic cod) Pathway gmh03420   Nucleotide excision repair gmh04110   Cell cycle gmh04114   Oocyte meiosis gmh04120   Ubiquitin mediated proteolysis gmh04141   Protein processing in endoplasmic reticulum gmh04310   Wnt signaling pathway gmh04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:gmh00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     115531294 (rbx1)    04120 Ubiquitin mediated proteolysis     115531294 (rbx1)   09124 Replication and repair    03420 Nucleotide excision repair     115531294 (rbx1)  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     115531294 (rbx1)    04350 TGF-beta signaling pathway     115531294 (rbx1)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     115531294 (rbx1)    04114 Oocyte meiosis     115531294 (rbx1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:gmh04121]     115531294 (rbx1)    03400 DNA repair and recombination proteins [BR:gmh03400]     115531294 (rbx1) Enzymes [BR:gmh01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      115531294 (rbx1) Ubiquitin system [BR:gmh04121]  Ubiquitin ligases (E3)   UBL E3 ligases    115531294 (rbx1)   Multi subunit type E3    SCF complex     Ring finger protein      115531294 (rbx1)    Cul2 complex      115531294 (rbx1)    Cul3 complex      115531294 (rbx1)    Cul4 complex      115531294 (rbx1)    Cul7 complex      115531294 (rbx1)    Cul8 complex      115531294 (rbx1)    Cul9 complex      115531294 (rbx1) DNA repair and recombination proteins [BR:gmh03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       115531294 (rbx1)     TCR (transcription coupled repair) factors      Cul4-CSA complex       115531294 (rbx1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 PHD_NSD Motif Other DBs NCBI-GeneID:  115531294 NCBI-ProteinID:  XP_030196326 Ensembl:  ENSGMOG00000002046 UniProt:  A0A8C5F3W2 LinkDB All DBs Position 2:complement(95990..97740) Genome browser AA seq 108 aa AA seqDB search MAAAMDVDTPSGTNSGASKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggcggcggcgatggatgttgatactcccagcggcaccaacagtggcgccagcaagaag cgcttcgaagtgaagaagtggaacgccgttgcgctctgggcatgggacatcgtcgtggat aactgtgccatctgtcggaaccacatcatggatctatgcatagagtgccaggccaatcag gcctctgcaacgtccgaggagtgcaccgtggcctggggggtctgcaaccatgcgttccac ttccactgtatctcccgctggctgaagaccagacaggtgtgtccactggacaacagagag tgggagttccagaaatatggacattag

DBGET integrated database retrieval system