Galleria mellonella (greater wax moth): 113517209 Help Entry 113517209         CDS       T09996                                  Name (RefSeq) GTP-binding nuclear protein Ran   KO K07936   GTP-binding nuclear protein Ran Organism gmw  Galleria mellonella (greater wax moth) Pathway gmw03008   Ribosome biogenesis in eukaryotes gmw03013   Nucleocytoplasmic transport gmw03250   Viral life cycle - HIV-1 Brite KEGG Orthology (KO) [BR:gmw00001]  09120 Genetic Information Processing   09122 Translation    03013 Nucleocytoplasmic transport     113517209    03008 Ribosome biogenesis in eukaryotes     113517209   09125 Information processing in viruses    03250 Viral life cycle - HIV-1     113517209  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:gmw03019]     113517209    03009 Ribosome biogenesis [BR:gmw03009]     113517209    03016 Transfer RNA biogenesis [BR:gmw03016]     113517209    03036 Chromosome and associated proteins [BR:gmw03036]     113517209   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:gmw04147]     113517209    04031 GTP-binding proteins [BR:gmw04031]     113517209 Messenger RNA biogenesis [BR:gmw03019]  Eukaryotic type   mRNA surveillance and transport factors    Transport factors     Ran-mediated transport factors      113517209 Ribosome biogenesis [BR:gmw03009]  Eukaryotic type   Pre-40S particles    Export and cytoplasmic maturation factors     113517209   Pre-60S particles     113517209 Transfer RNA biogenesis [BR:gmw03016]  Eukaryotic type   tRNA transport factors    tRNA export factors     113517209 Chromosome and associated proteins [BR:gmw03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Regulators of centriole replication      113517209    Spindle formation proteins     113517209 Exosome [BR:gmw04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    113517209 GTP-binding proteins [BR:gmw04031]  Small (monomeric) G-proteins   Ran Family    Ran     113517209 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RNA_helicase Gtr1_RagA AAA_24 G-alpha ArgoMid Pox_A32 AAA_16 AAA_7 AAA_22 Septin DUF5906 TsaE Motif Other DBs NCBI-GeneID:  113517209 NCBI-ProteinID:  XP_026757598 UniProt:  A0A3G1T1H9 LinkDB All DBs Position Unknown AA seq 214 aa AA seqDB search MTDADMPTFKLVLVGDGGTGKTTFVKRHLTGEFEKRYVATLGVEVHPLVFHTNRGPIRFN VWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTSRVTYKNVPNWHRDLVRVCEGIPIVLCGN KVDIKDRKVKAKTIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDGNLEFVAMPAL VPPEVTMDPQLVNQIEKDLKEAQDTALPEEDEDL NT seq 645 nt NT seq  +upstreamnt  +downstreamnt atgacggacgctgatatgcccacttttaagctcgtgttggttggcgatggtggtaccgga aaaaccactttcgtgaaacgtcacttgactggtgaattcgaaaaacgatacgttgccaca cttggtgtcgaagtgcatcctttagtgttccacacaaaccgcggccccatcagatttaat gtttgggatacagctggccaggagaaatttggaggcctaagagatggttactacattcaa ggtcaatgtgctatcataatgttcgatgtaacctcccgtgtcacttacaaaaatgtacca aactggcacagggacttggtgcgtgtgtgtgaaggcattccaattgtactgtgtggcaac aaagttgatatcaaagacagaaaagttaaggcaaaaacaattgtattccacaggaaaaag aaccttcagtattatgatatctcagctaaatcaaactataatttcgaaaagcctttccta tggcttgcaagaaaattgattggtgatggcaacttggaatttgtagctatgcctgccctg gtacctccagaagttacaatggatccacaactggtgaaccaaatcgaaaaagatctcaag gaagcccaagacactgctctgccagaggaggatgaagatttgtaa

DBGET integrated database retrieval system