Galleria mellonella (greater wax moth): 113523580 Help Entry 113523580         CDS       T09996                                  Name (RefSeq) RING-box protein 1A   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism gmw  Galleria mellonella (greater wax moth) Pathway gmw03420   Nucleotide excision repair gmw04120   Ubiquitin mediated proteolysis gmw04141   Protein processing in endoplasmic reticulum gmw04310   Wnt signaling pathway gmw04341   Hedgehog signaling pathway - fly gmw04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:gmw00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     113523580    04120 Ubiquitin mediated proteolysis     113523580   09124 Replication and repair    03420 Nucleotide excision repair     113523580  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     113523580    04341 Hedgehog signaling pathway - fly     113523580    04350 TGF-beta signaling pathway     113523580  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:gmw04121]     113523580    03400 DNA repair and recombination proteins [BR:gmw03400]     113523580 Enzymes [BR:gmw01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      113523580 Ubiquitin system [BR:gmw04121]  Ubiquitin ligases (E3)   UBL E3 ligases    113523580   Multi subunit type E3    SCF complex     Ring finger protein      113523580    Cul2 complex      113523580    Cul3 complex      113523580    Cul4 complex      113523580    Cul7 complex      113523580    Cul8 complex      113523580    Cul9 complex      113523580 DNA repair and recombination proteins [BR:gmw03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       113523580     TCR (transcription coupled repair) factors      Cul4-CSA complex       113523580 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  113523580 NCBI-ProteinID:  XP_026765375 UniProt:  A0A6J1X9S1 LinkDB All DBs Position Unknown AA seq 113 aa AA seqDB search MASVMDVDEEEVEMASSSSGKGDKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIE CQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggcttctgtaatggacgttgatgaagaagaagtcgagatggcttcctcgagtagtggt aaaggagataaaaaaagattcgaagttaaaaagtggaacgccgtcgcattgtgggcctgg gacattgtggtggataactgcgccatctgccgtaatcatataatggatttgtgtatagag tgtcaagccaatcaagcatcagccaccagcgaggaatgtacagttgcatggggagtctgt aatcatgcctttcatttccactgcatctcacgttggttgaaaacgcgccaagtttgtccc ttagacaacagagaatgggagttccagaagtatggacattag

DBGET integrated database retrieval system