Glycine max (soybean): 100306485 Help Entry 100306485         CDS       T01710                                  Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism gmx  Glycine max (soybean) Pathway gmx00510   N-Glycan biosynthesis gmx00513   Various types of N-glycan biosynthesis gmx04141   Protein processing in endoplasmic reticulum Module gmx_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:gmx00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     100306485    00513 Various types of N-glycan biosynthesis     100306485  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     100306485 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost5 Motif Other DBs NCBI-GeneID:  100306485 NCBI-ProteinID:  XP_014620887 UniProt:  I1MSH1 LinkDB All DBs Position 13:complement(20915878..20917792) Genome browser AA seq 76 aa AA seqDB search MAPKPITSPVPDSWYPTLSVFTLAIGLVLTASFFIYEATSSRKSRSLVQELTTGAVASVF LGFGSLFLLLASGVYV NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggctccaaaaccgataacgagtcccgtccccgattcgtggtaccccacgctctccgtc ttcaccctcgccatcggcctcgtcttaaccgcctctttcttcatttatgaagcaacatct tctaggaaaagtcgttcacttgttcaggagctgacaactggtgcagtggcttcagtcttc ttgggttttgggtccttgttcctcctacttgcttctggtgtttatgtctaa

DBGET integrated database retrieval system