Glycine max (soybean): 100789570 Help Entry 100789570         CDS       T01710                                  Name (RefSeq) RING-box protein 1a   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism gmx  Glycine max (soybean) Pathway gmx03420   Nucleotide excision repair gmx04120   Ubiquitin mediated proteolysis gmx04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:gmx00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     100789570    04120 Ubiquitin mediated proteolysis     100789570   09124 Replication and repair    03420 Nucleotide excision repair     100789570  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:gmx04121]     100789570    03400 DNA repair and recombination proteins [BR:gmx03400]     100789570 Enzymes [BR:gmx01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      100789570 Ubiquitin system [BR:gmx04121]  Ubiquitin ligases (E3)   UBL E3 ligases    100789570   Multi subunit type E3    SCF complex     Ring finger protein      100789570    Cul2 complex      100789570    Cul3 complex      100789570    Cul4 complex      100789570    Cul7 complex      100789570    Cul8 complex      100789570    Cul9 complex      100789570 DNA repair and recombination proteins [BR:gmx03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       100789570     TCR (transcription coupled repair) factors      Cul4-CSA complex       100789570 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  100789570 NCBI-ProteinID:  XP_003527486 UniProt:  I1KFB5 LinkDB All DBs Position 6:complement(48829930..48833013) Genome browser AA seq 116 aa AA seqDB search MATLDSDVPMVPAGEPSSSAGPSSKKPKRFEIKKWNAVALWAWDIVVDNCAICRNHIMDL CIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atggcgactctggattccgacgtgcctatggttcccgccggcgagccctcgagcagcgcc ggtccttcttccaagaagcccaagcgcttcgagatcaagaagtggaacgccgtcgctctc tgggcttgggacatcgttgtcgataactgtgctatctgccggaaccacatcatggatctc tgcatcgagtgccaagccaaccaggctagcgccactagcgaggaatgcactgtggcatgg ggagtctgtaaccatgcttttcacttccattgcattagtcgatggctcaagacccgtcaa gtttgtcctctagataacagtgagtgggagtttcagaaatatggccactag

DBGET integrated database retrieval system