Gimesia panareensis: Pan110_16120
Help
Entry
Pan110_16120 CDS
T07079
Symbol
fabG_4
Name
(GenBank) 3-oxoacyl-[acyl-carrier-protein] reductase FabG
KO
K00059
3-oxoacyl-[acyl-carrier protein] reductase [EC:
1.1.1.100
]
Organism
gpn
Gimesia panareensis
Pathway
gpn00061
Fatty acid biosynthesis
gpn00780
Biotin metabolism
gpn01100
Metabolic pathways
gpn01110
Biosynthesis of secondary metabolites
gpn01212
Fatty acid metabolism
gpn01240
Biosynthesis of cofactors
Module
gpn_M00083
Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:
gpn00001
]
09100 Metabolism
09103 Lipid metabolism
00061 Fatty acid biosynthesis
Pan110_16120 (fabG_4)
09108 Metabolism of cofactors and vitamins
00780 Biotin metabolism
Pan110_16120 (fabG_4)
09110 Biosynthesis of other secondary metabolites
00333 Prodigiosin biosynthesis
Pan110_16120 (fabG_4)
09180 Brite Hierarchies
09181 Protein families: metabolism
01004 Lipid biosynthesis proteins [BR:
gpn01004
]
Pan110_16120 (fabG_4)
Enzymes [BR:
gpn01000
]
1. Oxidoreductases
1.1 Acting on the CH-OH group of donors
1.1.1 With NAD+ or NADP+ as acceptor
1.1.1.100 3-oxoacyl-[acyl-carrier-protein] reductase
Pan110_16120 (fabG_4)
Lipid biosynthesis proteins [BR:
gpn01004
]
Fatty acid synthase
Component type
Pan110_16120 (fabG_4)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
adh_short_C2
adh_short
KR
Epimerase
GDP_Man_Dehyd
Motif
Other DBs
NCBI-ProteinID:
QDU49293
LinkDB
All DBs
Position
complement(2107315..2108088)
Genome browser
AA seq
257 aa
AA seq
DB search
MPASTTHPQRFQNRIALVTGGSRGIGRACCLRLAEEGARVAINYRQGKEDAEETLQQIRT
VGGTGMLVQADVSSSEQVDRMVSEIETEWGEVELLVNNSGIFSYEPHTELTEESWRQMMD
VNLTGTFLVTWRVREGMLKQKFGRIVNMSSLSGLMPRPMSIAYAVSKAGVVSFTQSTAVA
WAGENIRVNAIAPGLIDTEILSGVNQDDLDKIIQATPIPRMGKASEVASMVSFLLSEESS
FTTGQTVVISGGRCMLP
NT seq
774 nt
NT seq
+upstream
nt +downstream
nt
atgccagcatccactacccacccacaaagatttcagaatcgaatcgcactggtaacaggg
ggttcccggggaatcgggcgggcctgctgcctgcggctggcggaagaaggagcccgcgtt
gccattaactatcgccagggcaaggaagatgcagaggagacgctgcagcagatccggact
gtgggtggcaccggcatgctcgtgcaggctgacgtctcctcaagcgagcaggtcgatcgg
atggtcagtgagattgagactgagtggggtgaggtggaactgctggtcaacaattccggt
atcttcagttatgaaccacatacggaattaactgaagaatcgtggcgacagatgatggat
gtgaatctgacgggaacgtttctggtcacctggcgcgtcagggaaggcatgctgaaacaa
aaattcggacggattgtcaacatgagctccctctccggactgatgccccgtcccatgtca
atcgcgtacgcggtaagtaaagcgggagtcgtctcattcacccagagcactgccgtggcc
tgggcgggcgaaaatatccgggtcaatgccatcgccccgggactgattgataccgaaatt
ctctctggtgtgaatcaggacgatttggacaagatcattcaggcaactccgatcccgcgg
atggggaaagcatcggaagtcgcctccatggtttcatttctattgtctgaagaaagcagc
tttacgaccggccagaccgtcgtcatcagcggtggtcgttgcatgctgccctga
DBGET
integrated database retrieval system