KEGG   Paraglaciecola psychrophila: C427_2680
Entry
C427_2680         CDS       T02535                                 

Name
(GenBank) glutaryl-7-aminocephalosporanic-acid acylase
  KO
K07116  acyl-homoserine-lactone acylase [EC:3.5.1.97]
Organism
gps  Paraglaciecola psychrophila
Brite
KEGG Orthology (KO) [BR:gps00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    C427_2680
Enzymes [BR:gps01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.97  acyl-homoserine-lactone acylase
     C427_2680
SSDB
Motif
Pfam: Penicil_amidase
Other DBs
NCBI-ProteinID: AGH44789
UniProt: K7A177
LinkDB
Position
2525294..2527459
AA seq 721 aa
MIKKILLAVIALLTSIYIGFWATAPRSVDPAQYQILADKYDVHIVRDKYAVPHIFGTRDI
DAAFGLGYAHAEDDFATMQDVLLVTRGKLATLHGVDAAKTDYLVHFMDVWNVVDAGYESR
INQQTRDHAEAYADGVNFYASEKPDNIAVGLLPVTGKDIIAGFTFKTPLFYGFDQVVAAV
VEGRYGTGLDKLAHLHVTDSPQPDIGSQGIAIAPSRSDDGHTRLLVNSHQPLTGPVAWYE
ARVKTDEGWDMVGSTFPGSPVILHGHGPTLGWASTVNKPDLVDVYQLTINPNNGDQYLLD
GEWRDFEVKDAAIDVTFWGPIRWTFHEAIYRSVHGPVFKTEKGAFALRWAGMDEMRTLEE
MLAMNKARTQADFEAALSMTASPSINYVYADKDGNIAHYYNAMMPKRPEGDKFSAIDWQG
LVAGDRSDLIWQGYYPFERMPRTVNPPSGLVYNANNTPYRSSIGEGQPKPKDYESSMGIQ
TNMTNRALRIEALFGADKAISREDLHRYKYDNRYAEGSVVDLVLKRLLAMSFEPDSELQA
GQELLQNWDLGSDAESRVAALGVMTGSPFVMAVMRDEPEPDLVDVFQNALTLLQDHFGRI
DPKWGEVNRLVRGDKSWPLSGAPDVLRAVYGVFDEEAGHQQATAGDSYIMFVEWSPDGIL
TSHSIHNFGSATLDATSNHYDDQAPIFASEKERRLPLDMVKLMAEKTSDKIIGGDLNLEH
E
NT seq 2166 nt   +upstreamnt  +downstreamnt
atgattaaaaaaatactgcttgctgtcatagcattactaacttcaatttacatcggtttt
tgggctacagctcctcgctcagtggatccagctcaatatcaaatacttgcggataaatat
gatgtgcatattgtgcgtgataaatatgctgtgccgcatatctttggtacacgggatata
gatgctgccttcggtcttggttatgctcatgcggaagatgattttgcaaccatgcaggat
gttttacttgtgacccgtggcaaactcgcaacactacatggtgttgacgcggctaaaact
gattatctggttcattttatggatgtgtggaatgtggtggacgctggctatgagagtcgc
ataaatcagcaaactcgtgatcatgctgaggcctatgccgatggggtaaatttttatgcc
tctgaaaaaccagataatattgccgtgggattacttcctgtaacgggcaaagatattatt
gcgggtttcacttttaaaacacctttattttacggttttgatcaggtggttgcagcagtc
gttgaggggcgatacggcactgggctcgacaaacttgcacacttacacgtcactgattca
cctcaacctgatattggtagtcaaggtattgcaatcgcgccgtcgcgttctgacgatggt
catacacgtttactcgtgaattctcaccagccacttactggccctgttgcttggtatgaa
gcgcgagtaaaaacagacgaaggttgggatatggttggtagcacttttccgggctcaccg
gttattctgcatggacatggacctacactaggatgggctagcaccgtaaataagccagat
ttggtggatgtgtaccagttaacaattaatcccaacaacggggatcaatatttattagac
ggtgaatggcgagattttgaagtaaaagatgcggcaattgacgtcacgttttggggccca
attcgctggacgtttcacgaagctatttatcgctctgttcacgggcctgtttttaaaaca
gaaaagggagcctttgcgctgcgttgggctggaatggatgaaatgcggactcttgaagag
atgttagccatgaacaaagcgcgcactcaagctgactttgaagcggcgctatcgatgacc
gcctcgccgagcatcaattatgtgtatgctgacaaagacggtaatattgctcactactat
aatgcgatgatgcccaagcgacctgaaggcgacaagttctcggccatagactggcaaggt
ttagttgcgggtgaccggtcagaccttatttggcagggatattacccctttgaacgtatg
ccgcgcactgttaatcctccctctggtttagtctacaatgccaacaacactccttatcgt
tcttcgattggtgagggccaaccaaagcccaaagactatgagtcgtcgatgggaatacag
actaatatgactaatcgtgctttgcgcattgaagctttgtttggagcagacaaggctatc
agccgtgaagatttgcaccgttataaatatgataatcgctatgctgagggctcagtggtt
gatctagtgctcaaacgtttgttagctatgtcttttgaacccgatagtgagttgcaagca
gggcaagaactactacaaaactgggatttaggaagtgatgctgagagtcgagtggcggca
ctgggtgtgatgaccggcagtccatttgttatggcggtaatgcgtgacgagccagagcct
gacttagtagacgtttttcaaaatgcgctgactctgttacaagatcattttggtcgaatt
gatcccaagtggggtgaagtaaaccgtctggtacgcggtgataagagttggcccctttca
ggtgcacctgatgtgttgcgcgcagtatatggtgtatttgatgaagaggctggtcatcaa
caggcaactgctggagatagttacatcatgtttgttgaatggtcgccagatggtattctt
acctcacacagcattcataattttggcagcgccaccctcgatgcaacctcaaaccactat
gatgatcaggcacccatatttgcgtctgagaaagagcgacgcctacccttagatatggtc
aaacttatggctgaaaaaaccagtgacaagataattggtggggatcttaacttagagcat
gaataa

DBGET integrated database retrieval system