Gossypium raimondii: 105795701 Help Entry 105795701         CDS       T04129                                  Name (RefSeq) RING-box protein 1a   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism gra  Gossypium raimondii Pathway gra03420   Nucleotide excision repair gra04120   Ubiquitin mediated proteolysis gra04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:gra00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     105795701    04120 Ubiquitin mediated proteolysis     105795701   09124 Replication and repair    03420 Nucleotide excision repair     105795701  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:gra04121]     105795701    03400 DNA repair and recombination proteins [BR:gra03400]     105795701 Enzymes [BR:gra01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      105795701 Ubiquitin system [BR:gra04121]  Ubiquitin ligases (E3)   UBL E3 ligases    105795701   Multi subunit type E3    SCF complex     Ring finger protein      105795701    Cul2 complex      105795701    Cul3 complex      105795701    Cul4 complex      105795701    Cul7 complex      105795701    Cul8 complex      105795701    Cul9 complex      105795701 DNA repair and recombination proteins [BR:gra03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       105795701     TCR (transcription coupled repair) factors      Cul4-CSA complex       105795701 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 Motif Other DBs NCBI-GeneID:  105795701 NCBI-ProteinID:  XP_012480845 UniProt:  A0A0D2LT62 LinkDB All DBs Position 7:complement(52042335..52044539) Genome browser AA seq 118 aa AA seqDB search MATLDSDVPMVPVGESSNSSAASSSTKKPKRFEIKKWSAVALWAWDIVVDNCAICRNHIM DLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atggctactctagactccgatgtccccatggtacccgtcggcgagtcttccaacagctcc gccgcttcctcttccactaagaaacccaagcgtttcgagatcaaaaagtggagcgccgtt gccctttgggcttgggatattgttgtggataattgtgcaatttgtaggaatcacatcatg gatctctgtatcgaatgccaagcaaaccaagccagcgccaccagtgaggaatgcactgtt gcttggggggtctgcaaccatgcatttcactttcactgtatcagccgatggttgaagact cgtcaagtgtgtccattggataatagtgagtgggagttccaaaagtatggtcactaa

DBGET integrated database retrieval system