Globicatella sanguinis: CYJ72_007835 Help Entry CYJ72_007835      CDS       T09094                                  Name (GenBank) dihydrofolate reductase   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism gsg  Globicatella sanguinis Pathway gsg00670   One carbon pool by folate gsg00790   Folate biosynthesis gsg01100   Metabolic pathways gsg01240   Biosynthesis of cofactors gsg04981   Folate transport and metabolism Brite KEGG Orthology (KO) [BR:gsg00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     CYJ72_007835    00670 One carbon pool by folate     CYJ72_007835  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     CYJ72_007835 Enzymes [BR:gsg01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      CYJ72_007835 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DHFR_1 Motif Other DBs NCBI-ProteinID:  WIK65831 LinkDB All DBs Position 1745958..1746269 Genome browser AA seq 103 aa AA seqDB search MIIFVYAQDQQGGIGVNNQLPWNLPNDLKFFRDTTMGHTILMGRKTFESLGKRLLPGRKT IVLSRDPHYGADIQGLTVITNRQEALDMATQEALMVIGGTEIF NT seq 312 nt NT seq  +upstreamnt  +downstreamnt gtgattatctttgtatacgcccaagaccaacaaggaggcattggtgtcaacaatcaattg ccttggaatctacccaatgatttaaagttctttagagacacaactatgggacataccata ttgatgggacgcaaaacttttgaatctctcggcaaacgcctacttccaggacgaaaaaca attgttttgtctcgagatcctcattatggtgccgacattcagggcctgactgtgattact aatcgtcaagaagccttggatatggccactcaagaagccctcatggtcatcggtggaaca gaaattttttaa

DBGET integrated database retrieval system