Glycine soja (wild soybean): 114378027 Help Entry 114378027         CDS       T06057                                  Name (RefSeq) RING-box protein 1a-like   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism gsj  Glycine soja (wild soybean) Pathway gsj03420   Nucleotide excision repair gsj04120   Ubiquitin mediated proteolysis gsj04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:gsj00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     114378027    04120 Ubiquitin mediated proteolysis     114378027   09124 Replication and repair    03420 Nucleotide excision repair     114378027  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:gsj04121]     114378027    03400 DNA repair and recombination proteins [BR:gsj03400]     114378027 Enzymes [BR:gsj01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      114378027 Ubiquitin system [BR:gsj04121]  Ubiquitin ligases (E3)   UBL E3 ligases    114378027   Multi subunit type E3    SCF complex     Ring finger protein      114378027    Cul2 complex      114378027    Cul3 complex      114378027    Cul4 complex      114378027    Cul7 complex      114378027    Cul8 complex      114378027    Cul9 complex      114378027 DNA repair and recombination proteins [BR:gsj03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       114378027     TCR (transcription coupled repair) factors      Cul4-CSA complex       114378027 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  114378027 NCBI-ProteinID:  XP_028192332 LinkDB All DBs Position 12:8785643..8788640 Genome browser AA seq 116 aa AA seqDB search MATLDSDVPMVPAGEPSSSAGPSSKKPKRFEIKKWNAVALWAWDIVVDNCAICRNHIMDL CIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atggcgactcttgattccgacgtgcctatggttcccgccggcgagccctcgagcagcgcc ggtccttcttccaagaagcccaagcgcttcgagatcaagaagtggaacgccgtcgctctc tgggcttgggacatcgttgtcgataactgtgctatctgccggaaccacatcatggatctc tgcatcgagtgccaagccaaccaggctagcgccactagcgaggaatgcactgtggcttgg ggagtttgtaaccatgcttttcacttccattgcatcagtcgatggctcaagactcgtcaa gtttgtcctctagataacagtgagtgggagtttcagaaatatggccactag

DBGET integrated database retrieval system