Glycine soja (wild soybean): 114392517 Help Entry 114392517         CDS       T06057                                  Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism gsj  Glycine soja (wild soybean) Pathway gsj00510   N-Glycan biosynthesis gsj00513   Various types of N-glycan biosynthesis gsj04141   Protein processing in endoplasmic reticulum Module gsj_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:gsj00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     114392517    00513 Various types of N-glycan biosynthesis     114392517  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     114392517 SSDB OrthologParalogGFIT Motif Pfam:  Ost5 Motif Other DBs NCBI-GeneID:  114392517 NCBI-ProteinID:  XP_028209484 LinkDB All DBs Position 17:4172940..4175221 Genome browser AA seq 76 aa AA seqDB search MAPKPITSPVPDSWYPTLSVFTLAIGLVLTASFFIYEATSSRKSRSLVQELTTGAVASVF LGFGSLFLLLASGVYV NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggcaccaaaaccgataacgagtcccgtccccgattcgtggtaccccacactctccgtc ttcactctcgccatcggcctcgtcttaaccgcctctttcttcatttatgaagcaacatct tctaggaaaagtcgttcacttgttcaggagctgacaactggagcagtggcttcagtcttc ttgggttttgggtccctgttcctcctacttgcttctggcgtttatgtctaa

DBGET integrated database retrieval system