Glycine soja (wild soybean): 114417297 Help Entry 114417297         CDS       T06057                                  Name (RefSeq) RING-box protein 1a-like   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism gsj  Glycine soja (wild soybean) Pathway gsj03420   Nucleotide excision repair gsj04120   Ubiquitin mediated proteolysis gsj04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:gsj00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     114417297    04120 Ubiquitin mediated proteolysis     114417297   09124 Replication and repair    03420 Nucleotide excision repair     114417297  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:gsj04121]     114417297    03400 DNA repair and recombination proteins [BR:gsj03400]     114417297 Enzymes [BR:gsj01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      114417297 Ubiquitin system [BR:gsj04121]  Ubiquitin ligases (E3)   UBL E3 ligases    114417297   Multi subunit type E3    SCF complex     Ring finger protein      114417297    Cul2 complex      114417297    Cul3 complex      114417297    Cul4 complex      114417297    Cul7 complex      114417297    Cul8 complex      114417297    Cul9 complex      114417297 DNA repair and recombination proteins [BR:gsj03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       114417297     TCR (transcription coupled repair) factors      Cul4-CSA complex       114417297 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  114417297 NCBI-ProteinID:  XP_028238246 LinkDB All DBs Position 6:complement(46696918..46700035) Genome browser AA seq 116 aa AA seqDB search MATLDSDVPMVPAGEPSSSAGPSSKKPKRFEIKKWNAVALWAWDIVVDNCAICRNHIMDL CIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atggcgactctggattccgacgtgcctatggttcccgctggcgagccctcgagcagcgcc ggtccttcttccaagaagcccaagcgcttcgagatcaagaagtggaacgccgtcgctctc tgggcttgggacatcgttgtcgataactgtgctatctgccggaaccacatcatggatctc tgcatcgagtgccaagccaaccaggctagcgccactagcgaggaatgcactgtggcatgg ggagtctgtaaccatgcttttcacttccattgcattagtcgatggctcaagacccgtcaa gtttgtcctctagataacagtgagtgggagtttcagaaatatggccactag

DBGET integrated database retrieval system