Gavia stellata (red-throated loon): 104256257 Help Entry 104256257         CDS       T08384                                  Name (RefSeq) hepatic lectin-like   KO K06563   C-type lectin domain family 4 member L/M Organism gste  Gavia stellata (red-throated loon) Pathway gste03260   Virion - Human immunodeficiency virus gste03264   Virion - Flavivirus and Alphavirus gste03265   Virion - Ebolavirus, Lyssavirus and Morbillivirus gste03273   Virion - Lassa virus and SFTS virus gste04145   Phagocytosis gste04517   IgSF CAM signaling gste04625   C-type lectin receptor signaling pathway Brite KEGG Orthology (KO) [BR:gste00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03260 Virion - Human immunodeficiency virus     104256257    03264 Virion - Flavivirus and Alphavirus     104256257    03265 Virion - Ebolavirus, Lyssavirus and Morbillivirus     104256257    03273 Virion - Lassa virus and SFTS virus     104256257  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     104256257  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     104256257  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     104256257  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:gste04131]     104256257   09183 Protein families: signaling and cellular processes    04054 Pattern recognition receptors [BR:gste04054]     104256257    04515 Cell adhesion molecules [BR:gste04515]     104256257    04090 CD molecules [BR:gste04090]     104256257    04091 Lectins [BR:gste04091]     104256257 Membrane trafficking [BR:gste04131]  Endocytosis   Phagocytosis    C-lectin receptors     104256257 Pattern recognition receptors [BR:gste04054]  Membrane-bound pattern recognition receptors   C-type lectin receptors    104256257 Cell adhesion molecules [BR:gste04515]  Lectins   Selectins and C-type lectins    104256257 CD molecules [BR:gste04090]  Proteins   104256257 Lectins [BR:gste04091]  C-Type lectins   Asialoglycoprotein and DC receptors    104256257 SSDB OrthologParalogGFIT Motif Pfam:  Lectin_C SHP Motif Other DBs NCBI-GeneID:  104256257 NCBI-ProteinID:  XP_009808911 LinkDB All DBs Position Unknown AA seq 222 aa AA seqDB search MHWVPAVWFGVLSAPAGNIFTSLSCSFKDRNFFQQKLRSFFTVYLLLALSFLLIITLFAV SLSRVSAISSKLNEVHLEQKQNFSGRDFLLFPCGPRSREWEYFDGKCYYFSLTRMSWYKA KAQCEEMHSQLAIINSYAKQNFVMFRTRNERFWIGLTDSNSEGEWEWIDGTDYKTTFTFW KEGEPNNSGSNEDCAHVWISGKWNDVYCTFECYYVCEKPLPN NT seq 669 nt NT seq  +upstreamnt  +downstreamnt atgcactgggtgccagccgtctggtttggggtcctttcagcccccgcgggcaatattttc acatctctctcgtgttcttttaaagacagaaacttcttccagcagaagctgagatccttt ttcaccgtgtacttgctgctggccctctccttcttgctgatcatcaccctgttcgctgtg tcgctgtccagagtttcagccatttcttcgaaactcaacgaggtgcacctggaacagaaa cagaacttttccggcagggattttctcttgtttccctgcggaccccgctccagggaatgg gaatactttgacggaaaatgttactacttctccctaaccagaatgagctggtacaaggcg aaggctcagtgcgaagagatgcactcgcaactggctatcattaacagctacgccaagcag aattttgtcatgttcaggacaaggaatgagcgtttctggatcgggctcacggacagcaac tcggaaggggaatgggaatggatcgacgggaccgactacaaaaccaccttcacattttgg aaggagggagagcccaacaacagcggcagcaacgaagattgtgcccacgtctggatctcc gggaagtggaacgacgtctactgcaccttcgagtgctactacgtctgcgaaaagcctctg cccaactga

DBGET integrated database retrieval system