KEGG   Geobacillus thermodenitrificans: GTNG_0256
Entry
GTNG_0256         CDS       T00496                                 
Name
(GenBank) DNA ligase
  KO
K01972  DNA ligase (NAD+) [EC:6.5.1.2]
Organism
gtn  Geobacillus thermodenitrificans
Pathway
gtn03030  DNA replication
gtn03410  Base excision repair
gtn03420  Nucleotide excision repair
gtn03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:gtn00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    GTNG_0256
   03410 Base excision repair
    GTNG_0256
   03420 Nucleotide excision repair
    GTNG_0256
   03430 Mismatch repair
    GTNG_0256
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:gtn03032]
    GTNG_0256
   03400 DNA repair and recombination proteins [BR:gtn03400]
    GTNG_0256
Enzymes [BR:gtn01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.2  DNA ligase (NAD+)
     GTNG_0256
DNA replication proteins [BR:gtn03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    Other elongation factors
     GTNG_0256
DNA repair and recombination proteins [BR:gtn03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA ligase
     GTNG_0256
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     GTNG_0256
   MMR (mismatch excision repair)
    DNA ligase
     GTNG_0256
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      GTNG_0256
SSDB
Motif
Pfam: DNA_ligase_aden DNA_ligase_OB HHH_2 BRCT HHH_5 DNA_ligase_ZBD HHH Nlig-Ia PTCB-BRCT BRCT_2 HHH_3 HHH_8
Other DBs
NCBI-ProteinID: ABO65640
UniProt: A4IJY6
LinkDB
Position
286088..288100
AA seq 670 aa
MDRQQAKRRAAELRELLNRYGYEYYVLDRPSVPDAEYDRLMQELIAIEKQYPELKTSDSP
TQRIGGPPLEAFRKVTHRVPMMSLANAFNEGDLRDFDRRVRQEVGEAAYVCELKIDGLAV
SVRYEDGYFVQGATRGDGTTGEDITENLKTIRSLPLRLNEPVSLEARGEAFMPKASFLRL
NEERQARGEELFANPRNAAAGSLRQLDPKVAASRQLDLFVYGLANAEELGIESHSAALSY
LQSLGFKVNPERRRCATIDEVIAFVNEWKEKRPQLPYEIDGIVIKVDSFAQQRQLGATAK
SPRWAIAYKFPAEEVVTTLIGIEVNVGRTGAVTPTAILEPVRVAGTTVQRATLHNEDFIR
EKDIRIGDAVIIKKAGDIIPEVVGVVVDRRDGDEVPFTMPTHCPECESELVRLDGEVALR
CLNPKCPAQLRERLIHFASRSAMNIEGLGEKVVTQLFNAGLVHDVADLYQLTKEQLVGLE
RMGEKSAANLLAAIEASKQNSLERLLFGLGIRYVGAKAAQLLAEHFETMERLEAATKDEL
MAVPEIGEKMADSITTYFSQPEAVELLNELRTYGVNMAYKGRKRTAETPASSVLAGKTVV
LTGKLASMSRNEAKEQIERLGGRVTGSVSRSTDIVIAGEDAGSKLDKAQQLGIEIWDETR
FLQEISREEQ
NT seq 2013 nt   +upstreamnt  +downstreamnt
atggaccgccaacaagccaaacggcgcgcggccgagctgcgcgagctgttaaaccgctac
gggtatgaatattatgtgctcgaccggccgtccgtcccggatgcggagtatgaccggctt
atgcaagagctcatcgctattgaaaaacagtatccggagctaaaaacgagcgattcgccg
actcagcgaatcggcggcccgccgcttgaggcgtttcgcaaggtgacgcatcgcgtcccg
atgatgagcttagcaaacgcgtttaacgaaggcgatttgcgtgattttgaccgccgcgtt
cgtcaagaagtgggagaggcggcgtatgtgtgtgaattgaaaatcgacggtcttgccgtc
tcagttcgttatgaagacggctatttcgtccaaggagcgacgcgtggcgacggaacgaca
ggggaggacattacagaaaatttgaagacgatccgctcgctgccgctgcgcctcaacgag
ccggtgtcgctggaggcgcgcggcgaggcgttcatgccgaaagcgtcatttttacgcttg
aatgaagagcgccaagcgcgtggtgaagaactgtttgccaatccgcgcaacgccgcggcc
ggttcgctccgccagctcgatccgaaagtggcagcttcgcgccagctcgatctgtttgtc
tacggcttagccaatgctgaggagctgggcattgagtcacatagcgcggcgctcagctat
ttgcagtcgctcgggttcaaagtgaacccggagcgacggcgctgtgccacgattgatgaa
gtgatcgcatttgtcaacgagtggaaagagaagcggccgcaactgccgtatgagatcgac
ggcatcgtcattaaagtcgattcgtttgcccaacagcggcagctcggggcgacagcgaaa
agcccacgttgggcgatcgcctacaaattcccagccgaagaagtggtcaccacgctcatc
ggcatcgaggtgaatgtgggtcgcaccggcgctgtcactccgacggcaatcttagagccg
gttcgtgtcgccggcacgaccgtgcagcgcgccactcttcataacgaagattttattcgt
gagaaagatattcgcatcggcgatgccgtcattattaaaaaggcgggcgatatcatcccg
gaagtcgtcggtgtcgtcgtcgatcggcgcgacggggacgaagtgccgtttacaatgccg
acgcattgtccggaatgtgaaagcgaactcgttcgtcttgacggggaagtggcgctccgt
tgcttaaacccgaaatgcccggctcagctgcgtgaacggctcattcactttgcgtcaagg
tcggcaatgaacatagaagggttaggagaaaaagttgttacccaactgtttaacgctggc
cttgtccatgatgtcgccgatttgtaccagttgacgaaagaacagcttgtcgggctagaa
cggatgggtgaaaagtcggcagcgaatttgcttgcagcgattgaagcgtcaaagcaaaac
tcgcttgagcggctgttattcggccttggtatccgttatgtcggggcgaaggcggcccag
ctgttggccgaacatttcgaaacgatggagcgtctcgaggcagcgacaaaagacgaattg
atggccgtgccggagatcggggaaaaaatggccgactcgattaccacttatttttcccag
ccggaagcggttgagttgttgaatgagctgcgcacctatggtgtcaatatggcatacaaa
ggacggaaacggacggctgaaacgccagcctcatcggtgctggccggcaaaacggtcgtc
ctgaccggcaaacttgcgtcgatgtcacgaaatgaagcgaaagaacaaatcgagcggctc
ggcggtcgtgtcaccggcagcgtcagccgcagcaccgacatcgtcatcgccggtgaagat
gccggttcaaagctcgataaagctcagcagcttggcattgagatttgggatgaaacacga
tttttgcaagagataagcagggaggaacaatga

DBGET integrated database retrieval system