Gloeophyllum trabeum: GLOTRDRAFT_101369 Help Entry GLOTRDRAFT_101369 CDS       T03130                                  Name (RefSeq) RING/U-box   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism gtr  Gloeophyllum trabeum Pathway gtr03420   Nucleotide excision repair gtr04111   Cell cycle - yeast gtr04120   Ubiquitin mediated proteolysis gtr04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:gtr00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     GLOTRDRAFT_101369    04120 Ubiquitin mediated proteolysis     GLOTRDRAFT_101369   09124 Replication and repair    03420 Nucleotide excision repair     GLOTRDRAFT_101369  09140 Cellular Processes   09143 Cell growth and death    04111 Cell cycle - yeast     GLOTRDRAFT_101369  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:gtr04121]     GLOTRDRAFT_101369    03400 DNA repair and recombination proteins [BR:gtr03400]     GLOTRDRAFT_101369 Enzymes [BR:gtr01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      GLOTRDRAFT_101369 Ubiquitin system [BR:gtr04121]  Ubiquitin ligases (E3)   UBL E3 ligases    GLOTRDRAFT_101369   Multi subunit type E3    SCF complex     Ring finger protein      GLOTRDRAFT_101369    Cul2 complex      GLOTRDRAFT_101369    Cul3 complex      GLOTRDRAFT_101369    Cul4 complex      GLOTRDRAFT_101369    Cul7 complex      GLOTRDRAFT_101369    Cul8 complex      GLOTRDRAFT_101369    Cul9 complex      GLOTRDRAFT_101369 DNA repair and recombination proteins [BR:gtr03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       GLOTRDRAFT_101369     TCR (transcription coupled repair) factors      Cul4-CSA complex       GLOTRDRAFT_101369 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4_2 zf-C3HC4 Motif Other DBs NCBI-GeneID:  19298424 NCBI-ProteinID:  XP_007869782 JGI:  Glotr1_1_101369 UniProt:  S7RCG0 LinkDB All DBs Position Unknown AA seq 110 aa AA seqDB search MADSNMDVDPPTTAVSKKEGKQRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIDCQA NQISATSEDCNAAWGICNHAFHFHCISRWLKTRNVCPLDNREWELQKYGR NT seq 333 nt NT seq  +upstreamnt  +downstreamnt atggcggactcgaatatggacgtggaccctccgacgacggcggtgagcaagaaggagggg aagcagcggttcgaggtcaagaagtggaatgccgtcgctctgtgggcttgggacatcgtc gtagacaactgcgccatctgcaggaaccacatcatggatctctgcatcgattgccaggcg aaccagatctccgccacgagcgaggactgcaacgccgcgtggggcatctgcaaccacgcc ttccacttccactgcatctcgcggtggctcaagacgaggaatgtgtgcccgctcgataat agagagtgggagctgcagaagtacggccgataa

DBGET integrated database retrieval system