KEGG   Haloprofundus sp. MHR1: FCF25_09685
Entry
FCF25_09685       CDS       T05952                                 

Definition
(GenBank) NAD(P)-dependent oxidoreductase
  KO
K19660  L-arabinose 1-dehydrogenase [NAD(P)+] [EC:1.1.1.376]
Organism
halm  Haloprofundus sp. MHR1
Pathway
halm00053  Ascorbate and aldarate metabolism
halm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:halm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    FCF25_09685
Enzymes [BR:halm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.376  L-arabinose 1-dehydrogenase [NAD(P)+]
     FCF25_09685
SSDB
Motif
Pfam: Epimerase NAD_binding_10 3Beta_HSD RmlD_sub_bind Polysacc_synt_2 NAD_binding_4 GDP_Man_Dehyd DapB_N adh_short NmrA Semialdhyde_dh Ldh_1_N
Other DBs
NCBI-ProteinID: QCJ47369
UniProt: A0A4D7H913
LinkDB
Position
complement(1912489..1913283)
AA seq 264 aa
MTNVAITGAAGNVGREALRAFEDTDHEVTAITHREHDDLDSVVLDVTDAEAFSDALAGQD
VLVHLAANPSPTADWEGVFETNIDGTRNAYEAAVENSLDRVVFASSNHAVHQYNVDDPDD
PESMTDRVRTVRPDDPTLPDSFYGVSKVSGEALGQLYAARHDVDVVNLRIGWLLEPDDLR
ERNSDPEVDSQFLRAMWLSPDDCRRVVRDAVTASLDGDGLGDTGGEAVTAHGVSANDDRY
LSLTETRHALDYRPRDNSAAELDG
NT seq 795 nt   +upstreamnt  +downstreamnt
atgacgaacgtcgcaatcaccggagcggcgggaaacgtcggcagagaggcgctgcgcgcg
ttcgaggacaccgatcacgaggtgaccgcgataacccaccgcgagcacgacgacctcgac
agcgtcgtcctcgacgtgactgacgccgaggcgttctcggatgcgctcgcaggacaggac
gtgctcgtccacctcgcggcgaacccgtcgccgaccgccgactgggagggtgtcttcgag
acgaacatcgacgggacgcgcaacgcctacgaggcggccgtcgagaacagcctcgaccgc
gtcgtcttcgcctcctcgaaccacgccgtccaccagtacaacgtcgacgaccccgacgac
ccggagtcgatgaccgaccgcgtgcggaccgtccgcccggacgacccgacgctgcccgac
tccttctacggcgtctcgaaagtctccggcgaggcgctcgggcagctgtacgccgcgcga
cacgacgtagacgtcgtcaacctccgcatcggctggttgctcgaacccgacgacctccgg
gagaggaattctgacccggaggtcgactcgcagtttctccgtgcaatgtggctcagtccc
gacgactgtcggcgcgtcgttcgcgacgcggtgacggcgtcgctcgacggcgacgggctc
ggtgacaccggcggcgaggcggtgaccgcccacggcgtctccgcgaacgacgaccgctac
ctctcgctgaccgagacgcggcacgcgctcgactaccgaccgcgggacaactcggcggcc
gaactcgacgggtag

DBGET integrated database retrieval system