KEGG   Halocella sp. SP3-1: D7D81_19420
Entry
D7D81_19420       CDS       T05769                                 
Name
(GenBank) 3-oxoacyl-ACP reductase FabG
  KO
K00059  3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Organism
hals  Halocella sp. SP3-1
Pathway
hals00061  Fatty acid biosynthesis
hals00780  Biotin metabolism
hals01100  Metabolic pathways
hals01110  Biosynthesis of secondary metabolites
hals01212  Fatty acid metabolism
hals01240  Biosynthesis of cofactors
Module
hals_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:hals00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    D7D81_19420
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    D7D81_19420
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    D7D81_19420
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:hals01004]
    D7D81_19420
Enzymes [BR:hals01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.100  3-oxoacyl-[acyl-carrier-protein] reductase
     D7D81_19420
Lipid biosynthesis proteins [BR:hals01004]
 Fatty acid synthase
  Component type
   D7D81_19420
SSDB
Motif
Pfam: adh_short_C2 adh_short KR Sacchrp_dh_NADP AAA_31 F420_oxidored 3HCDH_N
Other DBs
NCBI-ProteinID: AZO96589
LinkDB
Position
complement(4031385..4032146)
AA seq 253 aa
MFELTDKVAIVTGAGSKRGIGRSIVLGLAEQGAKVVVCDVDFDGAKAVAEEVEKKGVESL
AVKVDVINEEDINQLVEKTIKKFGKIDILVNNAGITQPVKVLDTTAEDWDRIMDVNLKGS
FLCTKAVLPSMLEQKYGRVINVSSVSGKRGGGVFGGAHYSASKAGMLAFAKALSREVCPR
GITVNSVAPGLVATDIRGGVESQEKQKEMTADIPCRRMGKPEEIAATVCFLASKEAGYIT
GEDIDINGGSHMD
NT seq 762 nt   +upstreamnt  +downstreamnt
atgtttgaactaacagacaaagttgcgattgttacaggggccggttctaagagagggatt
ggtagatcaatagtattaggactggcagaacaaggagcgaaagtagttgtttgtgatgtt
gattttgatggtgctaaagcagtagctgaagaggtagagaaaaaaggggttgagtctctg
gcggtaaaagtagatgtaattaatgaagaagatataaatcaattagtagaaaaaacaatc
aaaaaatttggaaaaatagatatacttgttaataatgcagggataacacaaccagtaaaa
gttcttgatacaactgctgaagattgggaccgtattatggatgttaaccttaagggttct
ttcctttgtactaaagctgtattgccttcaatgttagaacagaagtatggtagagtaata
aatgttagttctgtttctggcaaacgtggtggtggtgtttttggaggggcgcattattct
gcttctaaggctggtatgctcgcttttgctaaggctttatctcgtgaggtttgtccaaga
gggattacagtaaactctgttgcccctggactggtagctacagatatccgtggtggtgtt
gagagtcaggaaaaacaaaaagaaatgactgcagatatcccctgtagaagaatgggtaaa
ccagaggaaattgcagcaacggtttgttttctagcttctaaagaagctggttatataaca
ggtgaggacattgatattaatggtggttctcacatggattaa

DBGET integrated database retrieval system