Homarus americanus (American lobster): 121862336 Help Entry 121862336         CDS       T07477                                  Name (RefSeq) RING-box protein 1A   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism hame  Homarus americanus (American lobster) Pathway hame03420   Nucleotide excision repair hame04120   Ubiquitin mediated proteolysis hame04141   Protein processing in endoplasmic reticulum hame04310   Wnt signaling pathway hame04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:hame00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     121862336    04120 Ubiquitin mediated proteolysis     121862336   09124 Replication and repair    03420 Nucleotide excision repair     121862336  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     121862336    04350 TGF-beta signaling pathway     121862336  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:hame04121]     121862336    03400 DNA repair and recombination proteins [BR:hame03400]     121862336 Enzymes [BR:hame01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      121862336 Ubiquitin system [BR:hame04121]  Ubiquitin ligases (E3)   UBL E3 ligases    121862336   Multi subunit type E3    SCF complex     Ring finger protein      121862336    Cul2 complex      121862336    Cul3 complex      121862336    Cul4 complex      121862336    Cul7 complex      121862336    Cul8 complex      121862336    Cul9 complex      121862336 DNA repair and recombination proteins [BR:hame03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       121862336     TCR (transcription coupled repair) factors      Cul4-CSA complex       121862336 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_16 Motif Other DBs NCBI-GeneID:  121862336 NCBI-ProteinID:  XP_042216487 LinkDB All DBs Position Unknown AA seq 114 aa AA seqDB search MSAMEVDPQEEEVEVPSSSTSKQDKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCI ECQANQASVTSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH NT seq 345 nt NT seq  +upstreamnt  +downstreamnt atgtcagcgatggaggtggatccacaggaggaagaagtcgaggtgccctcctcaagcacc tctaagcaggacaagaagaggttcgaggtcaagaagtggaatgctgtggctctctgggca tgggatattgttgttgacaactgtgccatttgccggaaccatattatggatttatgcata gaatgtcaagctaaccaggcctcagtaacatcagaagaatgtaccgtagcatggggagtg tgtaatcacgctttccattttcactgtatatcccgatggctgaagacccgtcaagtctgc cccctagataatagggaatgggaattccagaaatatggccactag

DBGET integrated database retrieval system