Helianthus annuus (common sunflower): 110893221 Help Entry 110893221         CDS       T05101                                  Name (RefSeq) transmembrane protein 258-like   KO K26502   transmembrane protein 258 Organism han  Helianthus annuus (common sunflower) Pathway han00510   N-Glycan biosynthesis han00513   Various types of N-glycan biosynthesis han04141   Protein processing in endoplasmic reticulum Module han_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:han00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     110893221    00513 Various types of N-glycan biosynthesis     110893221  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     110893221 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost5 Motif Other DBs NCBI-GeneID:  110893221 NCBI-ProteinID:  XP_035837278 LinkDB All DBs Position 12:complement(145919107..145919563) Genome browser AA seq 92 aa AA seqDB search MLVVVLGFPKKVASGGFSAKPITNPVLDVWYPSLAVLMLAVGLVITASFFIYEATSSRKN RSLAKELVIGAVTFVFLGFGSLFLLLSSGVYV NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgctggtggtggtgctgggttttccgaaaaaagtggctagtggaggattttccgcaaaa ccgataaccaaccccgttctagacgtttggtatccatcgttagcggtgctgatgctcgcc gttggcctcgtaatcaccgcatctttctttatctatgaagcgacctcttcgaggaaaaac cgtagtcttgctaaagaacttgtaataggggcagtcacatttgtctttttgggctttgga tccttgttcttgctcctttcttcaggtgtttatgtctga

DBGET integrated database retrieval system