Helianthus annuus (common sunflower): 110893699 Help Entry 110893699         CDS       T05101                                  Name (RefSeq) RING-box protein 1a   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism han  Helianthus annuus (common sunflower) Pathway han03420   Nucleotide excision repair han04120   Ubiquitin mediated proteolysis han04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:han00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     110893699    04120 Ubiquitin mediated proteolysis     110893699   09124 Replication and repair    03420 Nucleotide excision repair     110893699  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:han04121]     110893699    03400 DNA repair and recombination proteins [BR:han03400]     110893699 Enzymes [BR:han01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      110893699 Ubiquitin system [BR:han04121]  Ubiquitin ligases (E3)   UBL E3 ligases    110893699   Multi subunit type E3    SCF complex     Ring finger protein      110893699    Cul2 complex      110893699    Cul3 complex      110893699    Cul4 complex      110893699    Cul7 complex      110893699    Cul8 complex      110893699    Cul9 complex      110893699 DNA repair and recombination proteins [BR:han03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       110893699     TCR (transcription coupled repair) factors      Cul4-CSA complex       110893699 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  110893699 NCBI-ProteinID:  XP_021996499 LinkDB All DBs Position 12:complement(341217..344800) Genome browser AA seq 123 aa AA seqDB search MASVDTDVTMVPAGEGSGPSSSTASTSSSAKKPPKRFEIKKWNAVALWAWDIVVDNCAIC RNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQK YGH NT seq 372 nt NT seq  +upstreamnt  +downstreamnt atggcttctgtggacacggatgtgacgatggttccggcaggggagggttcagggccttct tcttcgacggcttccacctcttcttccgccaagaaaccacctaagcgttttgaaatcaaa aagtggaacgctgttgctctttgggcctgggatattgtcgtcgacaactgcgcaatctgt aggaaccacatcatggatctttgcattgaatgtcaggctaatcaagccagtgctaccagt gaggaatgcacagttgcttggggggtgtgcaaccatgcgtttcactttcattgtattagc agatggctgaaaactcgtcaagtgtgtccactagataacagtgaatgggaattccagaag tatggccactag

DBGET integrated database retrieval system