Helianthus annuus (common sunflower): 110897767 Help Entry 110897767         CDS       T05101                                  Name (RefSeq) RING-box protein 1a isoform X4   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism han  Helianthus annuus (common sunflower) Pathway han03420   Nucleotide excision repair han04120   Ubiquitin mediated proteolysis han04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:han00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     110897767    04120 Ubiquitin mediated proteolysis     110897767   09124 Replication and repair    03420 Nucleotide excision repair     110897767  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:han04121]     110897767    03400 DNA repair and recombination proteins [BR:han03400]     110897767 Enzymes [BR:han01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      110897767 Ubiquitin system [BR:han04121]  Ubiquitin ligases (E3)   UBL E3 ligases    110897767   Multi subunit type E3    SCF complex     Ring finger protein      110897767    Cul2 complex      110897767    Cul3 complex      110897767    Cul4 complex      110897767    Cul7 complex      110897767    Cul8 complex      110897767    Cul9 complex      110897767 DNA repair and recombination proteins [BR:han03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       110897767     TCR (transcription coupled repair) factors      Cul4-CSA complex       110897767 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 Motif Other DBs NCBI-GeneID:  110897767 NCBI-ProteinID:  XP_022000192 LinkDB All DBs Position 13:complement(51336094..51363158) Genome browser AA seq 82 aa AA seqDB search MDSDVAMVPAGDSTSLPGPSSSSKKPKRLEIKKWNAVALWAWDIVVDNCAICRNHIMDLC IECQANQASATSEECTIAWGCW NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggattcagacgtagcgatggttcccgccggtgactcaacgagtcttccaggtccttca tcatcttcaaagaaaccgaagcgtcttgaaatcaagaagtggaacgccgtcgctctttgg gcttgggatattgttgttgacaactgtgcgatttgtagaaatcacatcatggatctatgt attgaatgtcaagctaatcaggctagcgctaccagcgaagagtgtactattgcttggggt tgctggtga

DBGET integrated database retrieval system