Helianthus annuus (common sunflower): 110916508 Help Entry 110916508         CDS       T05101                                  Name (RefSeq) RING-box protein 1a   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism han  Helianthus annuus (common sunflower) Pathway han03420   Nucleotide excision repair han04120   Ubiquitin mediated proteolysis han04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:han00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     110916508    04120 Ubiquitin mediated proteolysis     110916508   09124 Replication and repair    03420 Nucleotide excision repair     110916508  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:han04121]     110916508    03400 DNA repair and recombination proteins [BR:han03400]     110916508 Enzymes [BR:han01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      110916508 Ubiquitin system [BR:han04121]  Ubiquitin ligases (E3)   UBL E3 ligases    110916508   Multi subunit type E3    SCF complex     Ring finger protein      110916508    Cul2 complex      110916508    Cul3 complex      110916508    Cul4 complex      110916508    Cul7 complex      110916508    Cul8 complex      110916508    Cul9 complex      110916508 DNA repair and recombination proteins [BR:han03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       110916508     TCR (transcription coupled repair) factors      Cul4-CSA complex       110916508 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  110916508 NCBI-ProteinID:  XP_022016917 LinkDB All DBs Position 16:10000457..10002354 Genome browser AA seq 113 aa AA seqDB search MDSDVAMIPAGDSSSLPGPSSKKPKRFEIKKWNAVSLWAWDIVVDNCAICRNHIMDLCIE CQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggattcagacgtagcgatgattcctgccggtgactcatcgagtcttccaggtccatct tcaaagaaaccgaagcgttttgaaatcaagaagtggaacgccgtttctctttgggcttgg gatattgtggttgacaactgtgcgatttgtagaaatcacatcatggatctatgtattgaa tgtcaagctaatcaggctagcgctactagcgaagagtgtactgttgcttggggtgtctgc aaccatgctttccattttcactgcattagccgttggctgaaaacacgtcaagtgtgccct ctagacaatagcgagtgggagtttcagaaatacggtcactag

DBGET integrated database retrieval system