Hyalella azteca: 108678153 Help Entry 108678153         CDS       T07535                                  Name (RefSeq) RING-box protein 1A   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism hazt  Hyalella azteca Pathway hazt03420   Nucleotide excision repair hazt04120   Ubiquitin mediated proteolysis hazt04141   Protein processing in endoplasmic reticulum hazt04310   Wnt signaling pathway hazt04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:hazt00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     108678153    04120 Ubiquitin mediated proteolysis     108678153   09124 Replication and repair    03420 Nucleotide excision repair     108678153  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     108678153    04350 TGF-beta signaling pathway     108678153  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:hazt04121]     108678153    03400 DNA repair and recombination proteins [BR:hazt03400]     108678153 Enzymes [BR:hazt01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      108678153 Ubiquitin system [BR:hazt04121]  Ubiquitin ligases (E3)   UBL E3 ligases    108678153   Multi subunit type E3    SCF complex     Ring finger protein      108678153    Cul2 complex      108678153    Cul3 complex      108678153    Cul4 complex      108678153    Cul7 complex      108678153    Cul8 complex      108678153    Cul9 complex      108678153 DNA repair and recombination proteins [BR:hazt03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       108678153     TCR (transcription coupled repair) factors      Cul4-CSA complex       108678153 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  108678153 NCBI-ProteinID:  XP_018021991 UniProt:  A0A8B7P9X9 LinkDB All DBs Position Unknown AA seq 116 aa AA seqDB search MSVLPMDVDTNDDEVEVPSSSTSKGDKKRFEVKKWIAVALWAWDIVVDNCAICRNHIMDL CIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atgtcagtactcccaatggatgttgacacaaatgatgacgaagtagaagttccttcctca agcacttcaaagggagataagaagagatttgaagtgaaaaagtggattgctgttgcactg tgggcttgggacatagtggttgacaactgtgccatttgccgcaaccacatcatggatctg tgcattgagtgtcaggcaaaccaggcttctgccacatcagaggagtgtacagtggcttgg ggcgtctgcaatcatgctttccacttccactgcatctctcgctggcttaagacacgtcag gtctgcccactggacaacagggaatgggagttccagaagtatggacattaa

DBGET integrated database retrieval system