Hevea brasiliensis (rubber tree): 110634308 Help Entry 110634308         CDS       T05150                                  Name (RefSeq) RING-box protein 1a   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism hbr  Hevea brasiliensis (rubber tree) Pathway hbr03420   Nucleotide excision repair hbr04120   Ubiquitin mediated proteolysis hbr04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:hbr00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     110634308    04120 Ubiquitin mediated proteolysis     110634308   09124 Replication and repair    03420 Nucleotide excision repair     110634308  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:hbr04121]     110634308    03400 DNA repair and recombination proteins [BR:hbr03400]     110634308 Enzymes [BR:hbr01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      110634308 Ubiquitin system [BR:hbr04121]  Ubiquitin ligases (E3)   UBL E3 ligases    110634308   Multi subunit type E3    SCF complex     Ring finger protein      110634308    Cul2 complex      110634308    Cul3 complex      110634308    Cul4 complex      110634308    Cul7 complex      110634308    Cul8 complex      110634308    Cul9 complex      110634308 DNA repair and recombination proteins [BR:hbr03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       110634308     TCR (transcription coupled repair) factors      Cul4-CSA complex       110634308 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  110634308 NCBI-ProteinID:  XP_021638939 UniProt:  G0WRD1 LinkDB All DBs Position Unknown AA seq 116 aa AA seqDB search MDTDVTMVPAGEASSSVAGPSSSTKKPKRFEIKKWNAVALWAWDIVVDNCAICRNHIMDL CIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atggacaccgacgtcaccatggtcccagcgggtgaggctagctcaagcgtcgccggacct tcatcttccaccaagaagcccaaacgtttcgaaattaagaagtggaatgccgtcgctctt tgggcctgggatattgttgtggataactgtgcgatttgtaggaaccatattatggatctt tgcattgagtgccaagcgaatcaagcaagcgctacaagtgaggagtgcactgttgcctgg ggtgtgtgcaatcatgcttttcacttccactgcatcagccgatggctcaagacccgccaa gtgtgccctcttgacaatagcgagtgggaattccaaaagtatggccactag

DBGET integrated database retrieval system