Hevea brasiliensis (rubber tree): 110651617 Help Entry 110651617         CDS       T05150                                  Name (RefSeq) transmembrane protein 258-like   KO K26502   transmembrane protein 258 Organism hbr  Hevea brasiliensis (rubber tree) Pathway hbr00510   N-Glycan biosynthesis hbr00513   Various types of N-glycan biosynthesis hbr04141   Protein processing in endoplasmic reticulum Module hbr_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:hbr00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     110651617    00513 Various types of N-glycan biosynthesis     110651617  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     110651617 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ost5 Motif Other DBs NCBI-GeneID:  110651617 NCBI-ProteinID:  XP_021662684 LinkDB All DBs Position Unknown AA seq 76 aa AA seqDB search MATKPITSPVPDSWYPTLSVSMLAIGLVITASFFIYEATSSKRNRSLAKELTTGALASFF LGFGSLFLLLASGIYV NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggctacaaaaccgatcacgagccccgtgcctgactcatggtatccaaccctatccgtc tctatgcttgcgattggcctcgtgatcactgcttccttcttcatctatgaagcaacatca tctaagcgaaatcgcagtcttgccaaggagcttacaacaggagcattggcatctttcttt ctgggtttcgggtccttgttcctgctgcttgcttctggtatttatgtttag

DBGET integrated database retrieval system