Hippocampus comes (tiger tail seahorse): 109514860 Help Entry 109514860         CDS       T04969                                  Symbol rbx1 Name (RefSeq) E3 ubiquitin-protein ligase RBX1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism hcq  Hippocampus comes (tiger tail seahorse) Pathway hcq03420   Nucleotide excision repair hcq04110   Cell cycle hcq04114   Oocyte meiosis hcq04120   Ubiquitin mediated proteolysis hcq04141   Protein processing in endoplasmic reticulum hcq04310   Wnt signaling pathway hcq04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:hcq00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     109514860 (rbx1)    04120 Ubiquitin mediated proteolysis     109514860 (rbx1)   09124 Replication and repair    03420 Nucleotide excision repair     109514860 (rbx1)  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     109514860 (rbx1)    04350 TGF-beta signaling pathway     109514860 (rbx1)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     109514860 (rbx1)    04114 Oocyte meiosis     109514860 (rbx1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:hcq04121]     109514860 (rbx1)    03400 DNA repair and recombination proteins [BR:hcq03400]     109514860 (rbx1) Enzymes [BR:hcq01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      109514860 (rbx1) Ubiquitin system [BR:hcq04121]  Ubiquitin ligases (E3)   UBL E3 ligases    109514860 (rbx1)   Multi subunit type E3    SCF complex     Ring finger protein      109514860 (rbx1)    Cul2 complex      109514860 (rbx1)    Cul3 complex      109514860 (rbx1)    Cul4 complex      109514860 (rbx1)    Cul7 complex      109514860 (rbx1)    Cul8 complex      109514860 (rbx1)    Cul9 complex      109514860 (rbx1) DNA repair and recombination proteins [BR:hcq03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       109514860 (rbx1)     TCR (transcription coupled repair) factors      Cul4-CSA complex       109514860 (rbx1) SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  109514860 NCBI-ProteinID:  XP_019723827 UniProt:  A0A3Q2Y1X0 LinkDB All DBs Position Unknown AA seq 108 aa AA seqDB search MAAAMDVDAPSCSSSGASKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggcagcggcgatggacgtagacgcacctagctgctccagtagcggagcaagcaagaag cgatttgaagtcaagaagtggaatgccgtggcactgtgggcctgggacattgttgtggat aactgtgctatatgtcgaaaccacatcatggatctttgtatagagtgccaggccaaccaa gcttctgccacgtctgaagagtgcacagtagcctggggtgtctgcaatcatgccttccac ttccactgtatttctcgctggctcaaaactcgacaggtgtgccctctcgacaacagagag tgggagttccagaagtatggacactag

DBGET integrated database retrieval system