Hippocampus comes (tiger tail seahorse): 109532657 Help Entry 109532657         CDS       T04969                                  Symbol rap1b Name (RefSeq) ras-related protein Rap-1b   KO K07836   Ras-related protein Rap-1B Organism hcq  Hippocampus comes (tiger tail seahorse) Pathway hcq04010   MAPK signaling pathway hcq04510   Focal adhesion hcq04517   IgSF CAM signaling hcq04520   Adherens junction Brite KEGG Orthology (KO) [BR:hcq00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     109532657 (rap1b)   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     109532657 (rap1b)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     109532657 (rap1b)    04520 Adherens junction     109532657 (rap1b)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hcq04147]     109532657 (rap1b)    04031 GTP-binding proteins [BR:hcq04031]     109532657 (rap1b) Exosome [BR:hcq04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    109532657 (rap1b)   Exosomal proteins of other body fluids (saliva and urine)    109532657 (rap1b)   Exosomal proteins of colorectal cancer cells    109532657 (rap1b) GTP-binding proteins [BR:hcq04031]  Small (monomeric) G-proteins   Ras Family    Rap [OT]     109532657 (rap1b) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 G-alpha AAA_16 Motif Other DBs NCBI-GeneID:  109532657 NCBI-ProteinID:  XP_019753170 UniProt:  A0A3Q2XVZ6 LinkDB All DBs Position Unknown AA seq 184 aa AA seqDB search MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDCQQCMLEILDTAG TEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDL EVERVVAKESGVGLARQWNSCAFLETSAKSKINVNEIFYDLVRQINRKSPVPGRTRKKST CQLL NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgcgtgaatataaactggtggttttaggatctggcggcgttggcaagtctgctttgaca gtccagtttgttcagggaatctttgtagagaagtacgaccccacaatagaagattcctac cgcaagcaagtggaggtggattgccagcagtgtatgttggagatcttggacacggcaggc acagagcagttcacagccatgcgtgacctgtacatgaagaatggtcaaggcttcgctttg gtttactccatcacggctcagtcgaccttcaatgaccttcaggacctgcgagagcaaatc ctccgtgtcaaggacacagatgatgttccgatgatcctggtgggcaacaagtgcgacctg gaggtggagcgtgtggtggccaaagagtcgggcgtgggcctcgctcgccagtggaactcg tgcgcctttctcgagacctccgccaagagcaagatcaatgtcaacgagattttctatgat ctagtgagacaaatcaacaggaagagtccagttcctgggagaactcgcaaaaaatccact tgtcaactcctctaa

DBGET integrated database retrieval system