Haemophilus ducreyi: HD_0978 Help Entry HD_0978           CDS       T00135                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism hdu  Haemophilus ducreyi Pathway hdu00790   Folate biosynthesis hdu01100   Metabolic pathways hdu01240   Biosynthesis of cofactors Module hdu_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:hdu00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     HD_0978 (folB) Enzymes [BR:hdu01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      HD_0978 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      HD_0978 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      HD_0978 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB UBA_HOIP tRNA-synt_1e Motif Other DBs NCBI-ProteinID:  AAP95859 UniProt:  Q7VMJ7 LinkDB All DBs Position 775887..776258 Genome browser AA seq 123 aa AA seqDB search MRKTKMADKVFIHELTAFAAIGAYDWEHTIKQRLVFNIEMAWDFTQAVMTEDLQYCLNYA EISEKILHFVESKPFKLVETVAHQVADFLQENYAIQALRIELHKPKAVAQASSVGVIVER GAD NT seq 372 nt NT seq  +upstreamnt  +downstreamnt atgaggaaaactaaaatggcggataaagtttttattcacgaattgaccgcatttgcggct attggcgcttatgattgggagcatacgattaaacaacgtttagtgtttaatatcgaaatg gcatgggattttacgcaagccgtgatgacggaagatctgcaatattgcttaaattatgca gagatttcagaaaaaatattgcactttgttgaatcaaaaccatttaaattagttgaaacg gtcgcacatcaggtagcggattttttgcaagaaaattatgcaattcaagcgcttagaatt gaattgcataagccaaaagcagttgctcaagcaagtagtgttggtgtgattgtggaacga ggtgccgattag

DBGET integrated database retrieval system