Haemophilus ducreyi: HD_1118 Help Entry HD_1118           CDS       T00135                                  Symbol folA Name (GenBank) dihydrofolate reductase   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism hdu  Haemophilus ducreyi Pathway hdu00670   One carbon pool by folate hdu00790   Folate biosynthesis hdu01100   Metabolic pathways hdu01240   Biosynthesis of cofactors hdu04981   Folate transport and metabolism Module hdu_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:hdu00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     HD_1118 (folA)    00670 One carbon pool by folate     HD_1118 (folA)  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     HD_1118 (folA) Enzymes [BR:hdu01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      HD_1118 (folA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DHFR_1 Motif Other DBs NCBI-ProteinID:  AAP95982 UniProt:  Q7VM78 LinkDB All DBs Position 890053..890538 Genome browser AA seq 161 aa AA seqDB search MFISLIVARTKNHVIGRHNQMPWHLPRDLMWFREKTIDKPIIMGRKTYESIGRLLPKRPN IILSRTELKIDGAYTATSLAEAIELAKKFTAEEIMVIGGGELFKQALPLAQRLYLTEIEA DIEGDTYFAFNEQDWQLIRKESSEIDEHNNYVCHFMQFERI NT seq 486 nt NT seq  +upstreamnt  +downstreamnt atgtttattagccttattgtggcgcgtacaaaaaatcacgtgataggccgccacaatcaa atgccttggcatttgcctcgtgatttaatgtggtttcgcgaaaagaccatagataaaccg ataattatgggacgtaagacctatgagtctattggccgtcttttgcctaagcgacccaat attattttatcgcgaactgaattaaagattgatggggcttatacggcaaccagcttagcc gaagcgattgaattagcaaaaaaatttacagctgaagaaataatggttattggtggagga gaattatttaaacaggcgctgccattagcccaaagactgtatttaacggagattgaagct gatattgaaggcgatacttattttgcgttcaatgaacaagattggcaattaattcgcaaa gaaagctcagaaatagatgaacataacaactatgtttgtcattttatgcaatttgagcgt atttga

DBGET integrated database retrieval system