KEGG   Helicobacter pylori Rif1: C695_03140
Entry
C695_03140        CDS       T02317                                 
Name
(GenBank) membrane fusion protein (mtrC)
  KO
K03585  membrane fusion protein, multidrug efflux system
Organism
her  Helicobacter pylori Rif1
Pathway
her01501  beta-Lactam resistance
her01503  Cationic antimicrobial peptide (CAMP) resistance
Brite
KEGG Orthology (KO) [BR:her00001]
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    C695_03140
   01503 Cationic antimicrobial peptide (CAMP) resistance
    C695_03140
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:her03036]
    C695_03140
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:her02000]
    C695_03140
   01504 Antimicrobial resistance genes [BR:her01504]
    C695_03140
Chromosome and associated proteins [BR:her03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    C695_03140
Transporters [BR:her02000]
 Other transporters
  Accessory factors involved in transport [TC:8]
   C695_03140
Antimicrobial resistance genes [BR:her01504]
 Gene sets
  Multipdrug resistance modules
   Multidrug resistance, efflux pump MexAB-OprM [MD:M00718]
    C695_03140
SSDB
Motif
Pfam: HlyD_3 HlyD_D23 Biotin_lipoyl_2 Biotin_lipoyl PYNP_C DUF3978 Bet_v_1
Other DBs
NCBI-ProteinID: AFV43421
LinkDB
Position
642754..643458
AA seq 234 aa
MIRKILIGLFLSFLSMEAGEKVYAIFNVKATQDSKLTLDSTGIVDSIKVTEGSVVKKGDV
LLLLYNQDKQAQSDSTEQQLIFAKKQYQRYSKIGGAVDKNTLEGYEFTYRRLESDYAYSI
AVLNKTILRAPFDGVIASKNIQVGEGVSANNTVLLRLVSHARKLVIEFDSKYINAVKVGD
TYTYSIDGDSNQHEAKITKIYPTVDENTRKVSAEALLSKPMAVGLFGDGFIQTK
NT seq 705 nt   +upstreamnt  +downstreamnt
atgatacgaaaaattttaataggactttttttgagttttttgagcatggaagctggcgaa
aaagtgtatgcgattttcaatgtgaaagcgacacaagattccaaactcaccttagacagc
acaggaattgtggatagcattaaggttactgaggggagcgtggtcaaaaagggcgatgtt
ttgttgcttttatataatcaagacaaacaggctcaaagcgattccaccgaacaacaactc
attttcgctaaaaagcaataccaacgatacagcaaaattgggggcgctgtggataaaaac
actctagagggttatgagttcacttacaggcgcttggagtctgattacgcttattctatt
gcggtattgaataaaaccattttaagagccccttttgatggcgtgatagcgagtaaaaac
attcaagtgggcgaaggggtgagcgcgaataacacggtgttattgagattagtcagccat
gctaggaaattagttattgaatttgattctaaatatattaatgcggtcaaagtaggggac
acttacacctattctatagacggggattctaatcagcatgaagctaaaatcactaagatt
taccccacggttgatgaaaacaccaggaaagtgagcgctgaagcccttttatctaagcct
atggcagtggggctttttggcgatgggtttatccaaacgaaataa

DBGET integrated database retrieval system